SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0286_0015 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0286_0015
Domain Number 1 Region: 65-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000995
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 
Weak hits

Sequence:  Esi0286_0015
Domain Number - Region: 185-241,274-285
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000393
Family alpha-D-mannose-specific plant lectins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Esi0286_0015
Sequence length 386
Comment expressed unknown protein [387] f:54032-60113
Sequence
MFRRVITTVMYGDGSSRSTAQDFLFDKSLDAWFEETGPFDYYGPGVAPVGERGFGHGNGR
GNTPVDNVLRMNEFLRVGHSIASVDRKFTAVLESDCNLVVYHLRGGGKKVKSLWRWGGGA
CSYVLHALAVRPLTTRLREDGALFPQDRSPMVWETSSFSSEGRCFVAIQDNGMLVVMAGN
DPSAPGNVLWSNNQAHVGWFRQNSFHAAVLPSGNLVVSQGDSPMHSAARRCVWGAFGCPG
DGGVMEWKLVWMSFRTKAGDIWCKVKGCDGDGAGEYSYYSDSGDNPGGNGTRDSSSWKRQ
SGGGGGAGVDGGAFDPWAAGRGGGREDDGGGGGGGGGGGISHLLTQPGAAIKKAAGRGVA
WLTEALAKIKSAAEDSAYAASRPRHW
Download sequence
Identical sequences D7FV20
Esi0286_0015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]