SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Esi0876_0002 from Ectocarpus siliculosus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Esi0876_0002
Domain Number 1 Region: 178-438
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-67
Family Protein kinases, catalytic subunit 0.0000776
Further Details:      
 
Domain Number 2 Region: 552-652
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000202
Family Tetratricopeptide repeat (TPR) 0.0087
Further Details:      
 
Weak hits

Sequence:  Esi0876_0002
Domain Number - Region: 636-695
Classification Level Classification E-value
Superfamily TPR-like 0.00266
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Esi0876_0002
Sequence length 697
Comment conserved unknown protein [698] r:2934-6947
Sequence
MADVAVIVLGVMAQIRDFAKDIKENDRQACRLIERVKAIEPAVLAVKQGTNMSSSESLRQ
LLGTVEMIRNFLGGYARMSNFNRALKRKSNASEFTQFGIHINEGVQALSLDIAVDAWAKE
DAADRLDDLENMVDTMERMERNRTENHAEILGVLKALRKDERLELTEWDEIDYDKDLDFK
GSSRLGSGGFGEVCTAKWNGSHVAVKRLLAGDLHRDDVRTLRKEIRIHSNLRFDHVVQLY
AASTIPPRLCLVVELASRGSLRENLHSSSEPLAHALQTAFLYDIARGMSFLHKKGILHRD
LKSANVLMFANGHLKLCDFGLSKIKTESSSRSKRGAVGTAQWMSPEEMDESPASERTDLY
SFGVVCFEVITRMEPFKGMNPTQVIKAVVLNERRPQIPEWASGSPDVVPLMEQCWKQDPG
HRPEGFGPVVQTLASVVSRNGDPRNHSAVAVDATSSPGTQRSVGPSSDGVGTAPDSVSDG
VEASPLVAEEEVGTTALPRDSGNVQAPSKDLLLANKALAPSAGTSGEFKQLTDMIDEDVI
TKGEDRLHQRPDHREMAKGMYGRAESSRKQGKYVEANSLYLEAIEIQRKTLGPDHPDLAE
TLNGRALVLKSQGKYAEADALYLRAIEIGEKTHGSSDHPDLATRLSNRADLLQGKYAEAD
SLSLRAIEIVENTLGPDHPDLAPCLSIRAILLKEQRF
Download sequence
Identical sequences Esi0876_0002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]