SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PP1S167_153V6.1 from Physcomitrella patens subsp. patens 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PP1S167_153V6.1
Domain Number - Region: 14-24
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00262
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 67-103
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PP1S167_153V6.1
Sequence length 221
Comment pep:novel scaffold:ASM242v1:DS545056.1:906511:908231:1 gene:PP1S167_153V6 transcript:PP1S167_153V6.1 description:""
Sequence
MEGKQVKPALPSAPPPAPPPAPPPRDPKIPLTFDEMWFNADDDIEDEDVRNRAKELKAHI
MKMAVYIRQYLEDILMVAVILQALQHLIVERPLDPFRWLAKFIREEGPLIADEIERCRKI
AAARQTAHDKAKSDAEEADRLACVAAEATAKALRDLEDAKLAAAARAAAEEGEKARMLKS
QQASKVAAVATDPVETPISKVGKKKELTKPAKPVMKPEWQK
Download sequence
Identical sequences A0A2K1IS17
PP1S167_153V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]