SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PP1S4_106V6.2 from Physcomitrella patens subsp. patens 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PP1S4_106V6.2
Domain Number 1 Region: 25-170
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.22e-20
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PP1S4_106V6.2
Sequence length 380
Comment pep:novel scaffold:ASM242v1:DS544893.1:794578:797368:1 gene:PP1S4_106V6 transcript:PP1S4_106V6.2 description:"Predicted protein "
Sequence
MEASIPPQPTTSSSSRGYSSSASFRESDVEFLQTEAREWLEAVLEEKLDPHTSLQDLLAD
GTILYRISLIVKENLGKLKGNAANRPAAAVPSPDVNRTRTSLKYQPYSYVEAFLKVCKDV
GLLDLDLFNPSDAVDKKDIRHVCVCLLRLSKKARTLNIHLPDFDNPKHTLLSPPPKHLMP
SDVVHNLRDSLQQPSNGPASAKSNIILDLDKEISSSAADLSMGDSESNSVSPEVDSRGLQ
QPRNALQDPENVGDFSGDLSAMEPKDLDEYVRPVNHNGLSEKPQPVVELGIGTLKASQSP
RKSPDALEQYGAKEKGMSRNPKGRYSWFPYAAGVVFVGVLVVMVVARERRRPSLGVYEVQ
PTDSLAEISRRTGNATWQEL
Download sequence
Identical sequences A9RE77
3218.JGI64938 PP1S4_106V6.1 PP1S4_106V6.2 jgi|Phypa1_1|64938|fgenesh1_pg.scaffold_4000053 XP_001752388.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]