SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379715518|ref|YP_005303855.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379715518|ref|YP_005303855.1|
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Cgl1923-like 4.71e-84
Family Cgl1923-like 0.00000000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379715518|ref|YP_005303855.1|
Sequence length 337
Comment proteasome assembly chaperones 2 (PAC2) [Corynebacterium pseudotuberculosis 316]
Sequence
MQEKNARMYELEFPAPEVSLKDSEGPTLIVALQGYADAGHAIDASAEHLLAALEHRPVAS
FNNDELIDYRSRRPSVTIEHNNIVSAEELALGIEVLRDNSGTPFLLLSGPEPDLRWDAFT
KAVADLVEHFGVSRTICLYAAPMAAPHTRPMVVSAHGNSTDLIDHHFSLDTRITVPGSAS
LQLERLLNKQGRNVAGYTAHVPHYLSASPYPQATLSLLEAVSSSTGLKFPLRTLEEDSRK
VAMQVEEQVANSAEIENVVRLLEQQYDEELERYREAHPEAVMPGDGVVPNAELLGEEFEK
FLADIDNRSLNGGKSEKEKEEPPHGDTADPSDEEKDL
Download sequence
Identical sequences A0A1L6CUU2
WP_014367190.1.16076 WP_014367190.1.38385 WP_014367190.1.38411 WP_014367190.1.40681 WP_014367190.1.43256 WP_014367190.1.56904 WP_014367190.1.6216 WP_014367190.1.73584 WP_014367190.1.75733 WP_014367190.1.81226 WP_014367190.1.85367 gi|379715518|ref|YP_005303855.1| gi|387140809|ref|YP_005696787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]