SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379716143|ref|YP_005304480.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379716143|ref|YP_005304480.1|
Domain Number 1 Region: 52-460
Classification Level Classification E-value
Superfamily Multiheme cytochromes 2.84e-131
Family Di-heme elbow motif 0.00000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379716143|ref|YP_005304480.1|
Sequence length 483
Comment Nitrite reductase periplasmic cytochrome c552 [Corynebacterium pseudotuberculosis 316]
Sequence
MSTHASKTRRRYLILTGAIVVTALITMSITALLINIMERKSEVTDHFAKVVNIDENVVDP
AEWGKNFPLQYESYLKTSEMGATTHGGSAKESRQPDDKDPRTEVAKSRIEEDPRLKEMWA
GYAFAVDYREARGHQYMLDDQRKTKRVTEFKQPGTCLNCHASTVKLMNDLGNGNVDEGFK
KMNKMSYKEVTQLAEHPVACIDCHDPKTMELRVTRPAFINGIRDLKASQGVKDFNVNRDA
THEEMRSYVCGQCHVEYYFEGEDKTLTFPWAKGIEIDQIWDYYKENGHVDFVNAKTGADI
VKAQHPEFDVWSNSIHAQNGVSCSDCHMPYERHGAKKVSSHHLQSPLLNINNSCMTCHNS
SDEEMKQRVEQIQDRFIHSRDQAFDSLTALIKDLEKAKDDPATPQDRLKLAREYQNKASF
YLDYVYSENSNGFHAPDYTQRIISDSLDASRKGQLVLQGVDPKTLEPSGVTQKNKEAAKT
RGH
Download sequence
Identical sequences A0A1L6D2L1
gi|379716143|ref|YP_005304480.1| WP_014367678.1.10260 WP_014367678.1.13534 WP_014367678.1.16076 WP_014367678.1.23262 WP_014367678.1.27807 WP_014367678.1.31683 WP_014367678.1.38385 WP_014367678.1.38411 WP_014367678.1.40681 WP_014367678.1.43256 WP_014367678.1.56904 WP_014367678.1.6597 WP_014367678.1.68185 WP_014367678.1.73584 WP_014367678.1.75733 WP_014367678.1.81226 WP_014367678.1.85367 gi|389851188|ref|YP_006353423.1| gi|387139424|ref|YP_005695403.1| gi|387141399|ref|YP_005697377.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]