SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379716144|ref|YP_005304481.1| from Corynebacterium pseudotuberculosis 316

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379716144|ref|YP_005304481.1|
Domain Number 1 Region: 27-159
Classification Level Classification E-value
Superfamily Multiheme cytochromes 3.33e-22
Family Di-heme elbow motif 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379716144|ref|YP_005304481.1|
Sequence length 161
Comment Cytochrome c nitrate reductase, small subunit [Corynebacterium pseudotuberculosis 316]
Sequence
MSAGMRKHRVLTSALVVQVLAIFVIGSFVGMGLYTFIYAKGYSYLGNDPKACVNCHVMEP
QYNAWLAGSHSAVATCNDCHVPHDNIVHKYLVKAEHGVNHGFKFTTGWFPDNIQIRDASR
KVTNEACLSCHGEFTSDIHGTYGENQIQCTHCHATVGHKTR
Download sequence
Identical sequences A0A1L6CWL5
gi|387141400|ref|YP_005697378.1| gi|379716144|ref|YP_005304481.1| WP_014367679.1.16076 WP_014367679.1.38385 WP_014367679.1.38411 WP_014367679.1.40681 WP_014367679.1.43256 WP_014367679.1.56904 WP_014367679.1.6216 WP_014367679.1.6597 WP_014367679.1.73584 WP_014367679.1.75733 WP_014367679.1.81226 WP_014367679.1.85367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]