SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410669441|ref|YP_006921812.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410669441|ref|YP_006921812.1|
Domain Number 1 Region: 10-155
Classification Level Classification E-value
Superfamily Phosphotyrosine protein phosphatases I 4.71e-38
Family Low-molecular-weight phosphotyrosine protein phosphatases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410669441|ref|YP_006921812.1|
Sequence length 157
Comment arsenate reductase [Methanolobus psychrophilus R15]
Sequence
MTGKRLQEKKKVLFLCTHNSARSQMAEGLLKAVSGGRYEAYSAGVEATHVDPRAVTVMQE
IGIDISSQRSKKAREFQDIVFDVAVTVCDRAKQACSICSMPLEVPASKDDDSPRAKKVIH
KGFDDPASAEGSKEEQLRVFRRVRDEIKEWIYITFKE
Download sequence
Identical sequences K4MAB8
WP_015052169.1.66729 gi|410669441|ref|YP_006921812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]