SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410670377|ref|YP_006922748.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|410670377|ref|YP_006922748.1|
Domain Number - Region: 78-121
Classification Level Classification E-value
Superfamily RING/U-box 0.0671
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410670377|ref|YP_006922748.1|
Sequence length 182
Comment hypothetical protein Mpsy_1172 [Methanolobus psychrophilus R15]
Sequence
MKLNPEIEIIESLAKTILVAARTAPKGKGIDDIVTCLLDGKDRDELANKMEELSDIKGMK
FLLRDAKNVRDSDAVVLIGLKSSGASGLDCGACGFETCKGMLETKKVKKEFSGPHCMIKY
LDLGIAVGCAASKAKDLCIDNRIMYSAGAAACYFEMMDADVAMALPLSVRGKNIFFDRPS
MK
Download sequence
Identical sequences K4MBF7
WP_015053097.1.66729 gi|410670377|ref|YP_006922748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]