SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410670966|ref|YP_006923337.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410670966|ref|YP_006923337.1|
Domain Number 1 Region: 435-545
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|410670966|ref|YP_006923337.1|
Sequence length 550
Comment sulfate transporter [Methanolobus psychrophilus R15]
Sequence
MQTTKTINRYFKESFSSDLKAGFITAIVALPLAIAFAMASGVEPVLGLYTAVIAGMLASS
VGGSRYSITGPTGAMTVIILSTVHSFGLEGLLLAGFLAGIFQILFGLLRLGKVVKYIPLP
VISGFTSGIGAIILIGQIPNALGMVIPARERVWETAYEIYTRLDIIDITAVMICIGTILL
LVRLPGLLAKLRYLSSLPASIIALFLAVLLTYNLNLEVPLVGTIPTELPSINMIALNVDL
VMAVLPAALTIALLGAIEALLCAVVCDGMTNTRHDSNRELLGQGIANIILPFFSGIPCTA
AIARSAVNIREGAKTQMSGIIHALILLAVLLFLGPIAAFIPKAYLAGVLILVSVRMINVT
EFKTIMNISKMDTAVLLATFLLTVFTDLVFAVQMGMFLSIILLFIRMTNIIDIHSMENYD
RTKGINATIFADPYLEKNVSVYTINGPFFFGAMNVFESKINEHISISKPHIILRMRYVPF
IDTTGLERLRSFIHSSRKMKQKVYITSVQPKVMSKLDIDKEFRHMIKNKEVLIFDSTQEA
LAYLKKENGD
Download sequence
Identical sequences K4MF79
gi|410670966|ref|YP_006923337.1| WP_015053679.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]