SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|410671236|ref|YP_006923607.1| from Methanolobus psychrophilus R15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|410671236|ref|YP_006923607.1|
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily RING/U-box 0.0335
Family Zf-UBP 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410671236|ref|YP_006923607.1|
Sequence length 79
Comment hypothetical protein Mpsy_2033 [Methanolobus psychrophilus R15]
Sequence
MKCYECSKNGKTSDTVGICIVCGRGVCKQHLVREDTPVWEGEYSIKLKCGMGVECKYEDV
QHIKKILCIPCHEALKENY
Download sequence
Identical sequences K4MG11
gi|410671236|ref|YP_006923607.1| WP_015053945.1.66729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]