SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|137184|CE32056_506 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|137184|CE32056_506
Domain Number 1 Region: 22-336
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 8.47e-63
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 442-660
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.61e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 340-436
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000353
Family Rhamnogalacturonase B, RhgB, middle domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|137184|CE32056_506
Sequence length 662
Sequence
MRSTLATSTALLSLTSLTWALLKASENNSTLVISNERLVAGVSKTRGYINLLTLDGQNLL
GKEDGNTGVGPYLDCYCTPSGFWTPGRGSNVDYQLFNGTDATGVKYGGISMGETYAPTGQ
RLEQYWFLREGETGLHTFSRVAYYNETAPFLRNLQELRTMFRPNHDPPLFTHFVTNEEFA
APRPSTEGQVTVQDATWYLPNKDDPYVQQVGDYFTKYTFQDTWRKHKSHGMWADGSGSAN
GSTYGAWLVHNTVETYFGGPLHSDLVVDGIVYNYISSNHHGDQTPNITHGFDRTFGPQYF
HFNKGGSLEELRADADQYGLNPSWNARFYDSIAKHVPNLVTAAGRGTFKAKVDLPKGAKN
AIAVLAQSGVDYQDNVYDTKAYQYWAEVSSNGDVSIDRVKAGNYRLTVHADGVFGDYIQD
DVKVNAGKNTNIKAKWNPESAGTELWRIGTPDKSSGEYRHGYAQSPTHPLLTDEYRLYWA
DYDFVTEFPEGVTYKVGRDDPSQALNYVHWSIFGGKANYERPEPVYEKINNWTILFDAKE
QQLKNRKTATFTVQLAGAKTAAGNTDVYNASEPYSNLPYTVNVNGRDLQPWVIPYHHSSS
CAVRSAVICYNIANKFVFDAKLLREGENTFVLSLPYGGKNYESALLPEALYVQYDAMRLE
LK
Download sequence
Identical sequences jgi|Didex1|137184|CE32056_506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]