SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|281396|CE176268_1798 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|281396|CE176268_1798
Domain Number 1 Region: 398-557
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.051
Further Details:      
 
Domain Number 2 Region: 289-387
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000412
Family Rhamnogalacturonase B, RhgB, middle domain 0.012
Further Details:      
 
Domain Number 3 Region: 47-271
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000816
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|281396|CE176268_1798
Sequence length 560
Sequence
MRTASLVAAFAAAKTVLAKGPFLQQVTSTQWIIGNDLWNLTQGATYATNLQYQGSDAVGK
AQGHYAGVDGETNLVYTSAKIVSNSPDFIDVAFSSTLGDLHWVIYPKLDGAYQYFVNKAL
PDLSIFRTLWRLDPDRFTHGYNTNKNERLPDFALYANAPEIQDETFEFPDGSYVTKYDFA
NYVRERDFVGVYGDQTGSWYIHPSNEYQPGNHLSQTLTVHRESATGDAVQLNVVQDTSHF
RVGTKTPQPVGKIWGPWLWYLNNGSVSDAKTRAAKERSAFPYAFLNNTAYHSRGSLSGKF
TLSDGRPAAGAAIFLGDVDTSTRPLVQGSGYYYTTFADASGSFSITNIRSGSYGLIAASN
GGKIGDVYTNFTASPVTIRASHTTNLGSLIWSIPSNTQPIFQVGAFDKKATGFTNSGPHV
HGLTEKGPANLTFIVGKCKAEDWYYASSKLGSWDVVFDASAPSRARKARLSVSLAGYSQS
TALSIYLNGNQTIGTISNKSLTSDPALYRSGTVSGEWRLLQYEIDAQYLKAGRNVLSFKT
ERYVLWRGVLWDSIILEWVL
Download sequence
Identical sequences jgi|Didex1|281396|CE176268_1798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]