SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|59511|e_gw1.9.283.1 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|59511|e_gw1.9.283.1
Domain Number 1 Region: 20-60,91-360
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.39e-61
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0098
Further Details:      
 
Domain Number 2 Region: 468-688
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-16
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.037
Further Details:      
 
Domain Number 3 Region: 364-457
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000129
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|59511|e_gw1.9.283.1
Sequence length 690
Sequence
MRHIISSILLTSFGLAAAHLTANETSAYLQLENDRLFVSVNKTTGGIDTLVLDGQDLLGS
AAYIPYTPGGSSGNGRYGVGPYLDCYCIPATGPSSTGSGSYTPGSIDPTYQLFKGVDTHN
VAYGGVVMSEVYPPTGQILEQYWFLRDGETGLHTFSRIAYHNSTSPFLRNLQEFRTLFRP
STELWTDLVTNEGLAAPMPIPNPASGNTTNAATVQDATWYLGNRTDDPYVEAFADYFTKY
TFAAEWRDQTAHGLFADGSQSKDNSTFGAWLVMNTKDTYYGGPTHSDLVVDGIIYNYMVS
NHHGAGTPNITDGFDRTFGPQYYHFNKGPAGASWQSLRDEAVRYASPSWNAHFYDTIAEH
IPNYVPTSRRGAWKAKVQLPKGAKNAIAVLAQNGIDYQDNAIDPLKFQYWADISRDGTVE
IDRVAAGTYRVTMYADGIFGDYIEDDIVISAGKTTHCGTLKWEAETAGTELWRIGTPDKA
GGEWRHGDVPLNTSLHPPEYRIYWGAYDYLTDFPEGVNFHVGKSDTYKDFNYIHWSVFGG
YANSRRPQQVAGSGEINNWTITFDVDQHALVHKEHATFTIQLAGAKTAAGNTDTFNATQP
WNDVPFVVAVNGHELEPWIIPYNKSSSCATRSAVSCYTLSHKFMFPTSYLSSNATNEFVL
SLPYNATDYESAVLPKSVYVQYDALRLEVK
Download sequence
Identical sequences jgi|Didex1|59511|e_gw1.9.283.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]