SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|75422|e_gw1.50.129.1 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|75422|e_gw1.50.129.1
Domain Number 1 Region: 408-567
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.81e-22
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 299-397
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000255
Family Rhamnogalacturonase B, RhgB, middle domain 0.021
Further Details:      
 
Domain Number 3 Region: 86-296
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000157
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|75422|e_gw1.50.129.1
Sequence length 569
Sequence
MGGFKLLGLAALASTSLAAPLEERAKQPKSFFKEAGNSTWVIGNDVWNVTQNLQYANKLW
YKGKDRVGQAVGHYVSYNGAASDLKWLSASVVDKGTDWINIKFVAAEGDFHWVIYDGLHG
SYQYFVNHALPTLGEFRTLWRLDNVSFPNARTNIRDGPLPALAEYAISTNVQDETWQKPD
GTFLTKYDWSSNVRDNDFHGVYGEEAGSWYLNPGKDYFNGDHLKQELFVHRESRTGDAVQ
LNMIHGTHYQAVSRDAFADGKVWGPWLWYLNDGSREDAASRAAQEEGKWPYKWYNDKAYQ
SRGKVQGRLLLSDGRPAAGAAVFLGDNNNSTISTLDQGKDFYYTSYADANGKFSFKDVRT
GSYALQAWGNGGAIRDVITNFTQNNVEIRKGDTTNLKDLSWKVTDKSKRIFQIGAFDRKT
DGFALADEEKPFEHGRISKAPGSLTYTVGSSTDADWYFGQSALGTWSVNFPAPKAAAASK
LTVSLAGFSQGSSCDILLNDVKIGNITSASLLNSQDTYRGATRNGEWRLLEFPVGAETFA
NGTNKLDIKVTRTTQWRGWLWDSLVLEQV
Download sequence
Identical sequences jgi|Didex1|75422|e_gw1.50.129.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]