SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|97257|fgenesh1_pm.1_#_371 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|97257|fgenesh1_pm.1_#_371
Domain Number 1 Region: 20-274
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.88e-89
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000000336
Further Details:      
 
Domain Number 2 Region: 364-527
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-48
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.000000712
Further Details:      
 
Domain Number 3 Region: 276-358
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000000451
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000396
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|97257|fgenesh1_pm.1_#_371
Sequence length 528
Sequence
MLFKSALLAAASLSSSALAAFGVTKSGSDFVVDAGSSNTLVFTVNGANCDITSIIYRGEE
FQYASKGSHISSGLGSATVSSTIVGSVAKITCTTSTLTHYYVVKSGESTIYMATYTTAEP
DIGELRYIARLNPTTLPSEYPFGVVSTTAGSSSAVEGSDVFIVDGQTRSKFYSSERFIDD
SRQCVYRGEDVHVCMLLNSQSYEASSGGPFFRDINSNNAGDSTNLYFYMNSGHVQTENFR
MGLHGPYAMAFTRSGIPQGGSSLDTSFFKDLSITGYVAASGRGQVSGTATGVGSSFQTVL
HWFNDAAQYWVYADSAGKFTSPAMKPGTYTQVLYQGEFKVKAASVTVSAGSTTTANIAAT
TETKTSVWRIGDWDGKPTGFRNAANQLRMHPSDTRMDSWGPLTYTVGSSSLGNVPMALVK
DTNQLTIKFTGATGSTLRVGTTLSFAGCRPGVVVNSWTATTPAAPTKIDSRGLTRGAYRG
FGEVYDFAIPSGTLTSGTNTVTITCVSGSTGDAFLAPNIILDAIELFQ
Download sequence
Identical sequences jgi|Didex1|97257|fgenesh1_pm.1_#_371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]