SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Didex1|102107|fgenesh1_pm.19_#_81 from Didymella exigua CBS 183.55 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Didex1|102107|fgenesh1_pm.19_#_81
Domain Number 1 Region: 720-915
Classification Level Classification E-value
Superfamily Sec7 domain 6.8e-71
Family Sec7 domain 0.00000381
Further Details:      
 
Domain Number 2 Region: 122-220,474-561,997-1085,1249-1334,1378-1400,1480-1594
Classification Level Classification E-value
Superfamily ARM repeat 2.69e-16
Family GUN4-associated domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Didex1|102107|fgenesh1_pm.19_#_81
Sequence length 1926
Sequence
MADHRHDDAPADVEGNTHPTDTEPPPPLPPALNVPVPNAADTPRSSEQIFDQRIHAAPRP
RTDSQSTAATAATAATRPSTRSSLVFVGTALDTIAASKDARKNKKLGDAANAALAAIKRE
GDPARINPELLFEPLQLASEVPNVPVSITALDCIGKLISYSYFSVPSEPHAEGARTSEGA
PLIERAIDTICDCFQGEATHPDVQLQIVKSLLAAILNDKIVVHGAGLLKAVRLTYNIFLL
SKSSANQQVAQGALTQMVGTVFERVKARLAVKEARLGLSRASLNDKDRSADSLDHEQGSP
GTDGSSGGGGGGDGDGDGDGDDDDDEPAQDADVEEPSDKAVDKHTGPKITLQSFENSMTF
NDDRIHDNAPTLVTRIKGKPSSRHVSGVGTSTPQTGADDDEEDEIFVKDAYLVFRAMCRL
STKGLSVDHAMDVRSQGMRSKLLSLHMVHTILHNNIAVFVSPYATIRSGSGDEPTTFVQA
IKQYLCLSLSRNGASSVKPVFEVAAEIFWQMLKYLRVMLKKEVEVFLKEIYLATLDKRAA
PAFQKQHVLGIFGRFAADPRALVEVYLNYDCDRTALDNMYQRVVEHLSKISSNPVTITPM
QQQAYQEHREKRARQMDWQTRGTLPPSLTTVSMNSANDADGAYPQEYAMKQEALEALVEI
LRSLVGWAQQSLPESTKAQPQDSRLSLDDPRLSMDARTLADSPAPGPDSGTVTPLAEDDY
SQLERAKQRKTAMTNAVRAFNYKPKKGLKVLIKDGFIPSDSPEDIARFFLDNDRIDKGAL
GEFLGEADPENIAIMHAFVDLMDFTKTRFVDALRRFLQSFRLPGEAQKIDRFMLKYAERY
MTGNPNAFANADTAYVLSYSVIMLNVDQHSKKMKGPRMTPEDFIKNNRGINDSADLPEDY
LRGIYDEIAHNEIVLNTEQEAAADKGLVAPQPAGGLGLASIGQALTGGARDLQREAIAQA
SEAMANKTEQLYKQLLRAQRRTATATPVSKYIPASSSKHVGPMFEVTWMPFLMALSGQAQ
DHNIEIVRLCIEGIKLAIRISCLFDLADARQAFVSFLARFTNLYNLSEMKAKSMEALKTL
IDVAHTEGNLLRESWREILTCVSQLDRFQLISAGIDERSVPDVLKSNTASQSKKNLHVPG
SRRRQSHVNSVHFSADVAEESRSTDIVRGVDRIFTNSANLSGEAIVDFVKALVQVSWQEI
QSSGQSESPRTYSLQKLVEISGYNMTRVRFEWTNIWHVLGAHFNEVGCHTNTNVVYFALN
SLRQLSMKFMEIEELPGFKFQKDFLKPFEHIINNASVVSVKDMVLRCLIQMIQARGENIR
SGWKTMFGVFTVAAREPYEGIVNLAFENVTQVYNTRFGVVISQGAFADLIVCLTEFSKNY
KFQKKSLQAIELLKSSVPKMLRTPECSLSAHAGYLKDSDKGSSIPKQPTRQTQEEQFWFP
VLFAFHDVLMTGEDLEVRSRALSYLFDTLVSYGSNFPRDFWDMLWRQLLYPIFMVLKSKS
EMTKVLNHEELSVWLSTTMIQALRNMIKLFTHFFDALEYMLDRFLDLLALCICQENDTLA
RIGSNCLQQLILQNVQKFTAEHWSLIVKAFVDLFHRTEASALFSAATSGSTPTPLNGTRA
NSDAQSIAESANINLDTPPATEPSESSTGLGINGLDAPHRPSLVTEPTAGDVPARQTSDL
EDYRPDDNPQQPPVVVTAARRRFFNQIITKCVLQLLMIETVQELFGNDAVYSHIPSHELL
RLMAVLKKSFHFARRFNAARDLRARLFREGFMKQPPNLLKQESGSASVYVAILFRMYLDT
APERAASRADTEKALIPLCADIVQSYIELDPDTQQRNIVTWRPVVVTVLDGYAGFPDAEF
ERLTSVFAPLVVGILGTDMAGHVQRAVQALVARIFQTSLGMPSVPLMQGERRESLASPEA
RTPRLR
Download sequence
Identical sequences jgi|Didex1|102107|fgenesh1_pm.19_#_81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]