SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15642978|ref|NP_228020.1| from Thermotoga maritima MSB8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15642978|ref|NP_228020.1|
Domain Number 1 Region: 286-549
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.52e-70
Family Tandem AAA-ATPase domain 0.000000000368
Further Details:      
 
Domain Number 2 Region: 109-281
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.63e-55
Family RecG "wedge" domain 0.0000000179
Further Details:      
 
Domain Number 3 Region: 488-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.08e-43
Family Tandem AAA-ATPase domain 0.0000000996
Further Details:      
 
Domain Number 4 Region: 7-105
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 1.46e-38
Family RecG, N-terminal domain 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15642978|ref|NP_228020.1|
Sequence length 780
Comment ATP-dependent DNA helicase RecG [Thermotoga maritima MSB8]
Sequence
MLCSRYFTSSLFLWGEALPTLLEEFLNEVEKMLKNQVNTRRIHQLLKELDDPLLENKDLE
EKLQAFLDYVKEIPNLPEARKRYRIQKSLEMIEKLRSWFLIDYLECSGEEVDLSTDIQYA
KGVGPNRKKKLKKLGIETLRDLLEFFPRDYEDRRKIFKLNDLLPGEKVTTQGKIVSVETK
KFQNMNILTAVLSDGLVHVPLKWFNQDYLQTYLKQLTGKEVFVTGTVKSNAYTGQYEIHN
AEVTPKEGEYVRRILPIYRLTSGISQKQMRKIFEENIPSLCCSLKETLPERILEKRKLLG
VKDAYYGMHFPKTFYHLEKARERLAYEELFVLQLAFQKIRKEREKHGGIPKKIEGKLAEE
FIKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAILDNYEAGFQT
AFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHA
LIQEDVHFKNLGLVIIDEQHRFGVKQREALMNKGKMVDTLVMSATPIPRSMALAFYGDLD
VTVIDEMPPGRKEVQTMLVPMDRVNEVYEFVRQEVMRGGQAFIVYPLIEESDKLNVKSAV
EMYEYLSKEVFPEFKLGLMHGRLSQEEKDRVMLEFAEGRYDILVSTTVIEVGIDVPRANV
MVIENPERFGLAQLHQLRGRVGRGGQEAYCFLVVGDVGEEAMERLRFFTLNTDGFKIAEY
DLKTRGPGEFFGVKQHGLSGFKVADLYRDLKLLEWAREDVQEIDVEGIELPEEIKLIEVG
Download sequence
Identical sequences Q9WY48
282085 APC4100 1gm5_A gi|15642978|ref|NP_228020.1| 243274.TM0205 gi|15642978|ref|NP_228020.1| NP_228020.1.35502 WP_010865074.1.100023 WP_010865074.1.29620 WP_010865074.1.43545 WP_010865074.1.45724 WP_010865074.1.51363 WP_010865074.1.56403 WP_010865074.1.79805 1gm5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]