SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352516858|ref|YP_004886175.1| from Tetragenococcus halophilus NBRC 12172

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352516858|ref|YP_004886175.1|
Domain Number 1 Region: 281-452
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 1.44e-47
Family MgtE membrane domain-like 0.0000352
Further Details:      
 
Domain Number 2 Region: 140-273
Classification Level Classification E-value
Superfamily CBS-domain pair 7.83e-31
Family CBS-domain pair 0.000000853
Further Details:      
 
Domain Number 3 Region: 11-138
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 1.29e-26
Family MgtE N-terminal domain-like 0.00000256
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352516858|ref|YP_004886175.1|
Sequence length 457
Comment magnesium transporter MgtE [Tetragenococcus halophilus NBRC 12172]
Sequence
MTRLDETQELEERFAQLREDLKGNYLQDFRENFLEMHIYEQSQFYQTLEKKQRQLVYAYL
SPKELADMFDALEEDNENIKDYLGEMRANYASEMLAQMYTDNAVDLLNTLDKKQMGKYLS
LMDEEDASEIKELLHYEDETAGAIMTTEFVSIVANQTVRSAMYVLKKVAKAAETIYYTYV
VDQDNQLVGVISLRDLLVSDDDEMVADILNDRVISVHVGDDQEDVAQTFRDYDFLALPVT
DYEDHLLGIVTVDDIIDVIDDEAASDYSGLAGVNVEEVHENPVKAASKRLPWLITLLFLG
MATASLINHYEALVSEASILAAFITLITGTAGNAGTQSLAVAVRRLAFNDNKAKSYLQTI
FGEVLTGVVTGFITGLTILVIVWIWKGNPILGFVIGMAMMCAITVANLAGSLIPMFMDKL
GFDPAVASGPFITTLSDLTSVLIYFNIASLFMSYFIG
Download sequence
Identical sequences G4L637
gi|352516858|ref|YP_004886175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]