SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CCU74468 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU74468
Domain Number 1 Region: 229-657,690-766
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 7.32e-189
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000153
Further Details:      
 
Domain Number 2 Region: 23-228
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 3.79e-62
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCU74468
Sequence length 930
Comment pep:novel supercontig:EF1:HF943565:3894797:3897700:-1 gene:BGHDH14_bgh00352 transcript:CCU74468 description:"RNR3/large regulatory subunit/ribonucleotide reductase"
Sequence
MFVVKRGTYPTPILPISTHFTLDGRKERVQFDKITARVSRLCYGLDSEHVDAGAITQKVI
SGVYKGTDSNKLKAAETAAYMTVTHPDYAILAARIAVSNLHKQTKKMFSHVVSDLYHYVN
PKNGKASPMISKSMFDNVMKHEAELNSAIVYDRDFNYQYFGFKTLERSYLLRLDGKIVER
PQHMIMRVAVGIHGSDIESAIETYNLMSSKYYTHASPTLFAAGTPQAQLSSCFLIDMKED
SIDGIYDTLKTCAMISKNAGGIGLNIHRIRATGAYIAGTNGNSNGIVPMLRVFNNTARYV
DQGGNKRPGAFAIYLEPWHADVFEFLDLRKNHGKEEVRARDLFYALWIPDLFMKRVEKNA
EWTLMCPNECPGLADVYGDDFDKLYENYEKEGKGRKTIKAQKLWYSILEAQTETGNPFML
YKDACNKKSNQKNLGTIRSSNLCTEIVEYSSPDEVAVCNLASLALPTYVDSTNGTYNFLK
LHEVCQVVVKNLNKIIDVNYYPVPEARTSNFRHRPIAIGVQGLADTFLALRLPFESPEAK
HLNKQIFETIYHAALTSSTELAKNLGTYETYEGSPASKGELQYDMWGVTPTDLWDWSSLK
SEIRLHGLRNSLLVAPMPTASTSQILGFNECFEPYTSNIYSRRVLAGEFQVVNPWLLKDL
VDMGLWSDNMKNRIISDGGSVQNIPNIPAEIKALYKTVWEISQRTIIQMAADRGAFIDQS
QSMNIHMKDPTMGKITSMHFAGWKLGLKTGMYYLRTMAASAPIQFTVDQEALLVADTNVA
RERINRKRQATGFVTQSPAPQLSARQINTIDNSSSNGSHIENAGASVAIKNETAPFGTDS
SPLRSEDEIEQNKNINDLAKASPVKTSVSQPTASKSSIDQNEPLDSEEKEVDIYAEAALQ
CRFSHPTLFINPYDQIGSIENPESCTMCSG
Download sequence
Identical sequences N1J9H4
CCU74468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]