SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU74623 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU74623
Domain Number 1 Region: 620-814
Classification Level Classification E-value
Superfamily Sec7 domain 3.66e-72
Family Sec7 domain 0.00000239
Further Details:      
 
Domain Number 2 Region: 1109-1334,1363-1505
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000144
Family HEAT repeat 0.063
Further Details:      
 
Weak hits

Sequence:  CCU74623
Domain Number - Region: 23-138,287-489,840-989
Classification Level Classification E-value
Superfamily ARM repeat 0.00487
Family Clathrin adaptor core protein 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CCU74623
Sequence length 1811
Comment pep:novel supercontig:EF1:HF943549:1513579:1519222:1 gene:BGHDH14_bgh04530 transcript:CCU74623 description:"transport protein sec71"
Sequence
MSSLVFVVTALEAIANSKEAQKNAPLIAAVQQALKEIKENEPQLPDPDIIFAPLQLATKV
GSISLCTTALDCIGKLISYSYFSVSSHQSSDKENLQNPLIERAIDNICDCFQGETTAVEI
QLQIVKSLLAAVLNDKIVVHGAGLLKAVRQVYNVFLLSKSSANQQVAQGTLTQMVGTVFE
RVKTRLDMKATRLNLLRLKNKSNNSSELTANSTDLNDVSTAGDVEDPIDENVAYETRSIE
EGPKLTLKDLENCKSFDDSLMGEGPTMVTQVKSRNSYQTLEEHVTPEEDIKDSIDSDEDE
DEVYIRDAYLVFRSFCNLSTKVLPADQLYDLKGQAMRSKLISLHLIQTLLSNNILVFTSP
LCTIKNSRSNEPTGFLQAIKFYLCLSITRNGASSVDKIFEICCEILWLMMKYMRASFKRE
IEVFLHEIYLALLERRNAPIAQKLYFMGILQRLCGDPRALVETYLNYDCDRNVDNMFQTL
IEDLSKAASVTVVVSPQLQQQHEEKVAKSGMYWLEWQSRGALPPSLSTSHITDRHTTSED
EVPKEYIMKRQALYCLVEALRSLVNWSQQGIADMAVGLETEGRNSEDLRNSIDQTINDNS
LRTGTTESTVPSTPFVDDDPEQLGKEKQRKTALSNAIQQFNFKPKRGIKLLISEKFIQND
SPEKIAQFLLAEERLDKAQIGEYLGEGEDLNIAIMHAFVDCMDFTKRRFVDALRQFLQSF
RLPGEAQKIDRFMLKFANRYVTGNPNAFANADTAYVLAYSVILLNTDLHSSKVAKRMTKL
DFIKNNRGINDNANLPDEYLNGIYDEIANEEIVLRSEREAAAAMGVTPIQPIGIAAGFGQ
ALATVGRDLQREAYLQQSEEISQRSELLFKDLFRNQRKNAAKNEANKFIPATSFKHVGPM
FGVTWMSFFSGLSGQMQNSHNIETIRLCMEGMKLAVRVACVFDLETPREAFVSVLKNCTN
LNNPTEIMAKNIEALKVLLEIGQTEGDLLKSSWRDVLMCVSQLDRLQLISDGVDEGSIPD
VSKSRIVAPSDSLSESRKSTQSLRPQRTRIRSTAASSSILMKIALEGRSDEFIKGVDRIF
TSTAKLSGDAIVHFVKALTEISWEEIKISGQNESPRTYSLQKLVEISYYNMTRVRFEWTN
IWGVLGEHFNRVGCYNNTAVVFFALDSLRQLSMRFMEIEELPGFQFQKDFLKPFEHVMSN
STVIAVKDMALRCLIQMIQARGENIRSGWRTMFGVFTVAAKEPYEGIVNLAFDNVNQIYK
TRFGVVISQGAFADLIVCLTEFSKNMKFQKKGLQALETLKSIIPTMLKTSECPISRQAKL
NPVSSLKLDEVPSAESRTSREESFWFPVLFAFHDVLMTGEDLEVRSNALNYLFDALIRYG
GDFPPNFWDTLWRHLLYPIFMVLKSSAELSDIASQEELSVWLSTTMIQALRNVIILFTHY
FNALEYMLDRFLDLLALCITQENDTIARIGSNCLQQLILQNVTKFKPENWSQIVGVFVEL
FERTTAYQLFTATTTSGASTGRESISLAEDFTDIKSLRINGTGSTTLDVEGLTDQESKSQ
SRSSNDLEDYKPQSELQQRPVVVTAARRKFFNQIITKCVLQLLIIETVNELFSNETVYAQ
IPSPELLRLMSLLKKSFLFARKFNENKELRMRLWREGFMKQPPNLLKQESGSAATYVSIL
LRMYHDEGEERKRNRDDTENALVPLCADIIRGFTLLEEDSQQRNIFAWRPVVVEVLEGYT
NFPAQGFEKHINTFYPLGVDLLSREQGVEVRIALQAMLRRVGEVQLGIPELRRPSTTMSP
ENTSRRSSRRD
Download sequence
Identical sequences N1JA09
CCU74623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]