SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU76752 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU76752
Domain Number 1 Region: 133-315
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-35
Family Hypothetical protein AT3g04780/F7O18 27 0.00099
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-17
Family Thioltransferase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CCU76752
Sequence length 332
Comment pep:novel supercontig:EF1:HF943534:367770:369034:-1 gene:BGHDH14_bgh03566 transcript:CCU76752 description:"thioredoxin"
Sequence
MSKTVAINSLQQFNEYLQTSHIVVTDFYADWCGPCRLVAPLYEQLSAHLSAPKQITFLKR
MYSSFSAVVCLESHLMRCARMPTFLVFQRGEVIEHVQGADMRKVQAIVQKLLPSTKDAPA
DATTGEKSTSHSSWRLGELPPGYHDVTDQVDLDGLDLSNADLKFGRARVLFDESKPTALQ
KGKQQETATKDWVESDSDEQLMLFIPFQSRIKIHSLLITSLPASSSTSTYELAMRPRTIK
IYTNHACTLGFEEAEEVTPTQEITLVDSDWDESGTATICLRYVKFQNVSSIVLFIVDGDG
SCERTRIDRLRLVGERGEKRDPGRLEKISHDD
Download sequence
Identical sequences N1JFU7
CCU76752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]