SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU81705 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU81705
Domain Number 1 Region: 66-206
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-49
Family Ran-binding domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCU81705
Sequence length 222
Comment pep:novel supercontig:EF1:HF943519:820304:821477:-1 gene:BGHDH14_bgh01934 transcript:CCU81705 description:"ran-specific GTPase-activating protein 1"
Sequence
MFSASSAFVGAADNMFSMFGGGAKKERKDDEDRGDNSGSAKAKREAEKEAAKEENNEEKD
ETPESEDVHFEPVIRLTEKVETKTNEELEEQTFKMRAKLFRFVKESNEWKERGTGDVRLL
KHKENGKTRLVMRRDKTLKVCANHYVVPDMKLSPNVGSDRSWVWNAAADVSEGEPEAQTL
AIRFANSDNANLFKEAFLKAQKENEALFSKTAEVEETAGEKP
Download sequence
Identical sequences N1JM70
CCU81705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]