SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU82112 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU82112
Domain Number 1 Region: 1147-1266
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000236
Family Pleckstrin-homology domain (PH domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCU82112
Sequence length 1290
Comment pep:novel supercontig:EF1:HF943523:308225:312365:-1 gene:BGHDH14_bgh01029 transcript:CCU82112 description:"putative INT1 protein/putative bud site selection protein BUD4"
Sequence
MEIPHQGFSGKESSPSPTRRTSIEKLQRASRVKNSTMFAREQKQEYDPTSIPVVERPLIK
SLHGNAYGGFGIEGFRNSGCFNSPRNRRDSVASNPGHSPSSTISRSPAKTTSGMQQNIVS
MNQPSPTKSSLATARYKMSAESEFANISEDISLERADLPPGHKLHRHAKSVTFDEAPPQV
QEFEATTPDISSIGTESRENSFDSADSDYDKNQEFHIYDEGEDDGFHDTDSMEQENSFDA
SLEDTEKTPVMEPDDWPCTTTEQQDRNSLSEKNKDTCTTLDEFSRPESRRSSNFRPSMEW
NNLTRPNTEKRPLPPIPGASPSKRYGSPGSPRSSVNNESVDSSPKILGYKTSHLNNLNDH
PKLDRGQVSLDEKLRYIVNPGIDSHRNDAVTQRDRRMRRAGTKDRNSHTPEREVQSIKVY
EDPNASHHSSDPLREQPQMANLQESDPRDNEDQSLRNISSQIHSYRNAPTSYPDYSFTDP
DIPIPSTEVDDYPDEDSEGESVIIKQEHDEESELSIFDMPEIIDGITSIQDNEEESIHAA
ELSESQYSEPTPINQSPADSSRFRFSNQLTTPPVSPSLRFKPSNDAEREGFTLSPESKSP
STYDNMRACRSHSFPDSPESDNQLINDPEHNDEEDRHVARSETPQKQINPLNPNTSDLDS
DDEFMMGTPESVIHHPVHSISPCESPSIPEQVATIKSASGSNKLKTRPSATSAELEAMLE
SRKNLGSDVPFVPPIPSRHRDRPMSLDRGFAQKAEMFSDRKPSYKRSLTLDIGNDIATDL
DNNLNRVVEAQKRGYLMRQNTKIVIATSDNGNSPHPRPHSTNNSPIKPEAPQSWTVEPWI
GKMRKSSAHSKPQSGRQQPSCQASAAPDIEANASESQKDLKKDSEEELVDEEHERGRLFV
RVLGVKDLNLPLPPSEKTWFSLTLDNGVHCVTTALLELGKNAPIGQEFELVVPNDLEFQL
TLNAKLVKPVKAKVIEPPTKAFKAHKPSTFSRVFSSPKKRKELEARQREEEKMYAKMKEK
ETRAKKASHQPTAWDLLSPLAAEDGSFARSYVCLKDHESRCFGRPLTVEVPCFNEWATEQ
LHQSSSIMSKRSSTIFQRKAPYKVAKLELQLLFVPKPRDATDDDMPKSMNSCIREMKEVE
MMLTRNWEGHLSQQGGDCPYWRRRYFKLCGNKLTAYHETTRQPRATINLANACKLIDDRT
ILTQKETIGRGGKRRKSGFAEEEEGYMFVEEGFRIRFNNGEVIDFYADTSADKEGWMRAL
DGCMGREADADRRGWCSMVLQHEHRHKQKA
Download sequence
Identical sequences N1JIP5
CCU82112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]