SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU82225 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU82225
Domain Number 1 Region: 15-155
Classification Level Classification E-value
Superfamily EF-hand 3.3e-25
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 2 Region: 261-343
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.0000000017
Family Mitochondrial carrier 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCU82225
Sequence length 348
Comment pep:novel supercontig:EF1:HF943559:212123:213534:1 gene:BGHDH14_bgh00425 transcript:CCU82225 description:"mitochondrial carrier protein"
Sequence
MKVSSEDPSARNRTLQLLWQRLDPSNRHELSLSDLKKGLMHIDHPLKNADTLLKDVFLAI
DRNEDEKIQYEEFRSFAETAEKPLYVLFQSIDRDQDGRLCRKDIENACIMAGLSLPNSNL
DHLFAKLDQDGNGFIDFFEWREFLLFAPTYTQVSIRTVLSLLNSVAMCKNETHTVPLQKN
PEGRDSLSLISKIFYGALSKIIERPAASPHNFGRTNSLQSTANHLSLSEKDCYPSSELNT
TIIDNACAPKTKSMSLLSDILPPPGYYISGAAAGVLSRTFTAPLDRIKVYLIADVSPSNE
PRQSLKETLSLKSTRRIGQPLIDACKIIWRSGGLCSFFAGTSSILSVI
Download sequence
Identical sequences N1JNJ0
CCU82225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]