SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU82991 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU82991
Domain Number 1 Region: 351-503
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-22
Family Ran-binding domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CCU82991
Sequence length 507
Comment pep:novel supercontig:EF1:HF943498:178422:180329:1 gene:BGHDH14_bgh03597 transcript:CCU82991 description:"hypothetical protein"
Sequence
MKIHPPNDDSATTGASEELKHAALSDESSENLQSVKCSEVAEISVVEKNDEKDTIKSIHT
KRSSSPLVTDVNPKENLTSNAIPLVKKRSRDQDDEPKDQNISISPEREHINEGAGNGNRT
TRLEPEKKRPRDASQDRLSEGSCEIKDPTSVEAPEINRVATKSNIEETSNLTKEPKTTEA
PKDSALSFANSTFASLANSTISPFGSLGASKKSIFSSSSNGDESKSVSDVTNNLSSPGKT
SFNGTNSFVHDSNDNKSTGLSFSSSTISSFVTHTNGSIFGSSIGSGFASSVGPKLSSFAA
PESKSPPIGTKRLKAFGAPESEENGCEGNDVRLSVEDEENATIGAELKSNKTPKVYIDDG
EAEEATLLQIRAKLFALESKDAGWKERGVGTLKINAPRTCVSYDEDGSVISGSFRFNGSV
DTLKEQGTSFAARLIMRQENTHRVVLNTIILPEMTFDNKNATSSSQLVFTAFEGDKEIKP
IMMLLKMSEANAKLFKSEVDSIKTQLP
Download sequence
Identical sequences N1JQV0
CCU82991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]