SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CCU83110 from Blumeria graminis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CCU83110
Domain Number 1 Region: 1426-1555
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-23
Family Ran-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CCU83110
Sequence length 1557
Comment pep:novel supercontig:EF1:HF943488:69880:74609:-1 gene:BGHDH14_bghG007539000001001 transcript:CCU83110 description:"ran-binding protein (putative)"
Sequence
MDQPPRANAAQLAARNIKNARGKHPRRPGQIPREKPTAQWAQPAGESGLFGGSIQATGTF
DFAAPSSLKLNQPSMGEATNSSSNSLDNADCRFAGDDRNLKRLFGQSAAPTEHNFGAANV
QKQPTETSFNFQSNVQPTKIGSDKSSTNVGFSFGSAPQPIPSSGNIFNSVAQSTPSSGNI
FNSVPSGNNGNSIFNFNNLSSSQVAQNSSFQIESSTQNSQPRTTPFTFGNNSDQSTLPAG
KNCFSFGAQQQGLAQNPIFSPGPNTISTNMFSTMQNTQNPSTDSKSNINITPSLPGSSLF
SSNLSDIKKTETPLSSNLFSTSTSNLFGNQHKATAPLADNTSNQISGTVGWTSEKSNTTN
QKPMTSNLTFQQPCAASSATPSHINLANISSESTTQNPSSIFSYPNLKDSKVPEPDNKDR
STEIASTMPPTTQQVDTQFSFLNQPEKNSTFLDKRNIFGSPSIGLSDVKTPEKISVFGQN
TREIWPRNTSYGQIGSETIENANAHMTTKKTEISEIQGTVSSTDVDSIKFKETNGKKIKA
DLEPSNIFTRNLHENSIIDDSKAAPQNIFEQATILSHIPKSDSILTSPMGKSVPFALDAY
SPVRSQDIPLVDKDSSKSAIPKGAQTALQIYDSRLEPRHQNRFTPDSIPENPSFRNLALI
SQIKDEEIDKKIPPGTDEVSRKHFYASYRLRSLNQAMAKLFADLPISSDPQTALEFFIEE
RRNILTECSNNTQSKRKSNVEDDEDQNPSKKRKPNNAEVSAHSLSVSEPEPVPSKSRTKR
KLEEVEECEFKDSSKRNKESDQSAQRVSNNLSHTSHDGCTSNLKSPSGDAVQQSNSLKNS
LYPQMHTSPSPNSNHERENENLSSPSDRDIRSNSIPKEILHKPFSTEKSATVNLKESETA
NIFRDILENSSSSAEPKSQKQASGVFDNSQSENSKISYPNPFSIVTSTPAESQTSKIPNL
TPETSSSAYNINNGRPRFDLVPTSSNAFNSNFTTPGSSFMAKKPLMSGKGSTDFLAQFKI
KAKESEAQEMEKDKIEDMESDEDEAEWEARWKKKRDTQKLESGKNDEQKRATFIPGKGFV
IQGLDATNSVASPHSDNKQSSEKLSTSDQPEIKNTSTHGINVSSNSSLQGFGSTRPEYLD
HSSSSNTIKFSQEESKVDQELIKASPFCQSGQDGILSSSKSNIEDESCSKKDLSTSLTDE
LKDERNSTNIESKAVLDQTNSKESSNESMISAAKNPTKSIFESTLATPNVNINPFAPKDD
NSQLIFNKKAAGSHNPFSISQNGASPSDNTWKIDNPIRFGSSPAGTSTPNPKNESPRSIF
QTSTPSLFSLQSNPKIESTLFSNSIIPSTKSFDSKDKQAPAGSSETSRPSLFSASTSEAG
LTGAAFVFGQPSGSSSLTTSFNKPTEANQTSNVDTSNSDHQNNDNDDEKQEQIDLTATGP
GEENEEILHEVRVKALKFVSQSEKSGKGWETKGIGPLRVLRHQERGTCRLLLRGDPSGKV
VLNKSILGNVNYENTGKTLKLLCASDSGKGLETWVLQLKTEEYAKELAAVLIKHKPV
Download sequence
Identical sequences N1JQU1
CCU83110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]