SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB05G29880.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB05G29880.1
Domain Number 1 Region: 187-252
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-20
Family DNA-binding domain from rap30 0.0041
Further Details:      
 
Domain Number 2 Region: 3-120
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.02e-19
Family Rap30/74 interaction domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB05G29880.1
Sequence length 260
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:5:16454062:16458052:1 gene:OB05G29880 transcript:OB05G29880.1 description:"Uncharacterized protein "
Sequence
MGEEGKYLETARAERSVWLMKCPPVVSRAWQAAVSSSDAAGANPNPVVAKVVLSLDPLKS
EENSLQFKMEMAQNNTGNTPKSYSLNMSKDFVPMCVISESNQGKLSCEGKVEHKFDMKPH
SDNLVNYGKLCRERTQKYMVKTRKVKVLEEDHRMNLIPLPGRVGLIPSGSKEKKKQTPTK
PSDAKRIRRDRRELENIIFKLFERQPNWALKALVQETDQPEQFLKEILNDLCFYNKRGPN
QGTHELKPEYKKSTEDTDAP
Download sequence
Identical sequences J3M8R4
OB05G29880.1 XP_006654626.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]