SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB06G29030.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB06G29030.1
Domain Number 1 Region: 171-264
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000102
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 264-294
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000693
Family CCCH zinc finger 0.0016
Further Details:      
 
Domain Number 3 Region: 98-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000458
Family CCCH zinc finger 0.0024
Further Details:      
 
Domain Number 4 Region: 34-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OB06G29030.1
Sequence length 299
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:6:16932272:16935389:-1 gene:OB06G29030 transcript:OB06G29030.1 description:"Uncharacterized protein "
Sequence
MEAGGKRASAEGANGVAAKRARASESSQMGVGSKLKPCTKFFSTSGCPFGSSCHFLHNFP
GGYQAVAKMANLGGPAVAAPPGRMPLGLGAPNGPPTSSVKTRMCNKYNTAEGCKWGSKCH
FAHGERELGKPMQLDNSMPRAMGSIPNGQFEAPPMPGPDIVPPSTFGASATAKISVDASL
AGGIIGKGGVNTKHISRMTGAKLAIRDNESNPNLKNIELEGTFDQIKHASAMVTELIVRI
SGNTNAPPAKNPGRGSHAGGPGSNFKTKLCENFNKGSCTFGDRCHFAHGESELRKSAAA
Download sequence
Identical sequences J3MFV9
OB06G29030.1 XP_006657138.1.55871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]