SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB09G12940.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB09G12940.1
Domain Number 1 Region: 49-291
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 2.1e-35
Family Plant cytotoxins 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB09G12940.1
Sequence length 578
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:9:4032448:4038127:1 gene:OB09G12940 transcript:OB09G12940.1 description:"rRNA N-glycosidase "
Sequence
MFINKHGTRQDGQVNIFLQYYLIWLSAYVKSPLQTNRAASNLVYNVDAAGGYEAFMTAFR
TLLGEHPNRKEVEGHHVLARQRARQPARWIHVKLVAGEETTTLAIRDDNVYLKGFMNKEG
EWYELSGPTERSARMLPPEYASSLLGCCDVGYRSILGADVDEKVLDMLTHATVLETSFTI
EAVRRLSGYRPHATDYVDPFVRLSLVRLIILVCESARIRKLYDTISSGLGSALTTWQVHY
LWNWKRMSRLLLQSSQGNSSDIWPRRDPQLEPLGITSARETLRIVDLLLNCPLPPARVPD
TDSLGDGLGRQRVELLAVRADFPRQLDAITVFDGKRGQVIYRRQQAADDHSSVLDYQEKG
KRWNEPWEALEKWAYRIAYTKRGNMMLTGPYRSISADGCFAIQVDVAGSGVFFWEWDGYD
KTYASQVNSAIPSYHTIDIGLGRAIHVAYAVMSNAVETDVQVELPLAGGTLVSGHVTARI
EGFGTMGSVLFSATTAVPISTVDSTVPLARSVVALQYGKRLYIQVKLRADTNEGVKDFED
TVITLGGRSSVEQLRTRHGTVLVNIVPHPKLRATRGCV
Download sequence
Identical sequences J3MWB5
OB09G12940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]