SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB10G13130.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB10G13130.1
Domain Number 1 Region: 1247-1546
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-75
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 447-620
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.47e-44
Family Retroviral integrase, catalytic domain 0.0031
Further Details:      
 
Domain Number 3 Region: 1134-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000795
Family EGF-type module 0.0055
Further Details:      
 
Weak hits

Sequence:  OB10G13130.1
Domain Number - Region: 265-291
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000272
Family Retrovirus zinc finger-like domains 0.0054
Further Details:      
 
Domain Number - Region: 1099-1142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0233
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB10G13130.1
Sequence length 1605
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:10:2874469:2888117:1 gene:OB10G13130 transcript:OB10G13130.1 description:"Uncharacterized protein "
Sequence
MAEKFSNKPHIFNGSDFDYWKKKMESYITSQGYDIWLKVNQPYEIPERIDTPALKLEFEN
NCKARNIILNGISRSDFDRVSHLATANKIWKALNDFHTGTSNIKELRKDVFKKEYIKFEM
KLGESLDDYLARFNKILSDLRSVDASYDVNYSQSEIARHFMNGLDMKVWDVKVTSIQKSI
DMNVLTLDILYTKLKTYEMNILSKNTDLKSTVLISSSGSSSESISLAAFAAFTALSDDQL
EEISEEDLVLAVNRISRDVSSIRIRRRGGPIRCFGCGQPNHIRSQCPKLGRVLVEFEDDG
EEDKSMNIAGVCLMAKSFEDSDDDDETFLARKENVWIVDSGCSRHMTGDKSWFSSLVRAS
RKDSIIFGDASTSTITATGSVKFSKDVMFWHRRLGHIGFDHLTRISGSDLIRGLPKLKKD
VDLVCSPCRHAKMVVCSHTPTFSVMTDAPGQLLHMDTVGPARVQSVGGKWYVLVIVDDFS
RYSWVFFMVTKDEAFEHFKSLYLRLAIQLPGSLRTIRSDNGGEFKNASFERFCNEKGLEH
QFSSPRVPQQNGVVERKNRSLVEMARTMLDEYSTPRKFWAEAVNTACYISNRVFLRSKLR
KTSYELRFGHTPKISHLRVFGCKCFVLKSGFLDKFESRSRDGLMLGYAAHSRGYRVLVLE
TNKIVETCEVTFDEASPGLSEVKRSVAQSRILSNTPELTPSNTSLPSAATLANCPKRCGD
VSFDYPFGIGDGCFRHPDFSLGCDSSTQPPKLFLQADDSVEISDNIDVSGQDVGDFLHFN
SFLATFTHVIPVKTGIDVYNFSWKSPGVSFTIVETMVIGVASCDLDVFLIGQDGAAKLLC
TVACPNKEIAEMVYMQDCAGPGCYFLSSETPVQTVQLQVIRHKTNNTLRYSNLSMLWDRI
NISIGGPVVWSIVDQTRCSRNMEDNSKGDYACVSNHSGCRTSVFRDTGYACQCNSGYIGN
PYILDGCKHDSGYNPRPEKRNCSRHCGTVEVPFPFGLEEGCSARNLFRLTCSDETNSVVK
FNDFFQVMYINVSEGLLGIKYNSTFQEQQFNMMVKMIISSDEPDLFVDPLESASVQWAVA
NLTCQEAQQNTSGYACVSTSSTCLNVLSSMEGFIGYRCTCSPGYHGNPYIQDGCEDINEC
QETPGICKGVCHNTVGNYSCTKCPDHTEYDMLRMQCTPKRKQSFYSGIVIGLSSGFGMLL
LGLSGMVLIRRWQRHAQKRLQRKYFQKNQGLLFEQLISADENASEKTKIFSLEELKKATN
NFDTTRILGCGGHGTVYKGILSNQHVVAIKKAKVIRECEINDFINEVAILSQINHRNIVK
LFGCCLETEVPLLVYDFIPNGSLFGLLHPDSSSTIYLSWSDRLRIAAEAAGALCYLHSAA
SISIFHRDVKSSNILLDANYTAKVSDFGASRSVPIDQSHVITNVQGTFGYLDPEYYQTRQ
LNEKSDVYSFGVVLLELLLRKQPIFTTDSGMKQNLCSYFLSEIKTRPITDMVDAQVLEQA
SKEHIKEVASLAEMCLKLKGEERPRMKQVELTLQLLRTERMNSSQVDPAIDQEILPVLTE
GAIDPEKQALATNLDVHRANVASQCLQISCHSLEREFLSSASLPR
Download sequence
Identical sequences J3N1B5
OB10G13130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]