SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB10G20900.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB10G20900.1
Domain Number 1 Region: 1146-1298
Classification Level Classification E-value
Superfamily VC0467-like 2.49e-23
Family VC0467-like 0.0013
Further Details:      
 
Domain Number 2 Region: 964-1092
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000243
Family PDI-like 0.0092
Further Details:      
 
Weak hits

Sequence:  OB10G20900.1
Domain Number - Region: 103-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00102
Family PDI-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OB10G20900.1
Sequence length 1302
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:10:10699417:10706748:-1 gene:OB10G20900 transcript:OB10G20900.1 description:"Uncharacterized protein "
Sequence
MRLPLPPALPTPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXRPPLAAAWPLLLSLLAASRLPASAAAASSGATSGRAEWQVLTRANFSSQIRLHPH
VLLIVTMPWYGESRSLMAEIQRLVAADEQELGRLKLMVVHRNSEKLLTDVLDATEGIKFI
YYQHSLPFKYQGKLRTREILSSVHYIMSLKHAETPFVVLHTKEDVEAFVESTDKAVILSE
FCGWFSKLAHGGSNRTEGTSSNNHTENVDIPGKTLTRESDGPLELVIEDEELNFGGGVQL
TGSPWKGGFTLANGSVSDQIRITTDVNRTLCTAEKLHQFESFYAKLIALSRDYFLPPEKV
RFGLITERSSLPSLEFINEGNLETWFLSVHYLGCTNCSIVAKEGDDLRSLLQSYHNLDIN
EMDVDASGVATFPASRPSAILFIDRLSDSSKVRDESKLHLKLLREYVQKKYPSHFSTGGL
SNGKSRMSSRAVPSLMSTSRSAHTEQTRLSAWASKLMEFGDKMSVMVVNDGESISYRSAS
QGSTDNPLYDILTKLLQKTRPAHRSKKTRISFVTKDVGIKQPSDDSEVQVVESLSIRESQ
PERNDVSFASSDSRNDENRATEAEYIDDGQKPIKPEKGTANYYHTNEKLLESSDTEAEEQ
HKTKDSDVSLDLQEEISIDVHDSNAPENFCNISKDDLECSDAKMEKQEHKTEASVISSDL
QEEVSTDVHSSNQVGDILHKHKDEGTVREAVAILEHDGANVNFNQEKLGSAKQQDDVFPV
LGQEFRRIEDVIYEDNLFILDEGSEESDSKYPVHTALSSSSSLVGDNTEYTEQVTPSIPD
EHFAGSFFFSDGGYRLLRTLTGGSRIPSLVIIDPIQQKHYVFPDEIEFSYPSLASFFDCY
MNQSLSPYYRSALSVISSKELLRPPFINRDFHEADSIPQLTTSNFCMSVFGFEGCDSKNE
MPFSNTENIASAWKKDVLVLFSNSWCGFCQRTELVVCEVYQSLKNFGTSNSQFLRAQDLQ
EKNEESTMKGFPAIYLIDCTLNECHHLLKLAGKEEHYPTLLLFPAESKSAISYERGISVA
NLFEFLESHTSNSPHLLEYKGFLWKKKMVAQRDAPQAIQFDSSDKSSTEVGSHSPSHLER
HEARVLAGSVLTATAKLGSAVPFDNSQVLIVSADSHEGFQGLIINKRLSWDAFKNLDSSM
EPIKRAPLFYGGPVVVQGYYLVSLSRVAFDGYLQVMPGVYYGDVAATTQVTRQIKSGEQS
SENLWFFLGFSSWGYSQLFDELSEGAWQVSEEPIEHLVWPDN
Download sequence
Identical sequences J3N3J2
OB10G20900.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]