SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB11G23130.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB11G23130.1
Domain Number 1 Region: 82-171,263-446,478-547
Classification Level Classification E-value
Superfamily L domain-like 1.29e-43
Family Polygalacturonase inhibiting protein PGIP 0.014
Further Details:      
 
Domain Number 2 Region: 185-266
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.000000000915
Family Outer arm dynein light chain 1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB11G23130.1
Sequence length 556
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:11:12302557:12304277:1 gene:OB11G23130 transcript:OB11G23130.1 description:"Uncharacterized protein "
Sequence
MHVAAAKLALLAVAAAATSFSSHALADTGARCLPHERDALLAFKKGIAETTTASSFHGGG
EGGGKKTAAGGAASGLEGQISPCLVSLEHLEYLDLSNTGLRGINGSVPEFLGSFKNMRYL
DLSYMNSITRLPPQLGNLSKLEYLDLSRTYLLQVPRQLGNLSSLRHLDLSQTPFFYQAND
MPYMYNMIRGISWLAHLHLLEYLDMSYIDLSMAVDWPHLFNSLPRLEALHLSNCSLPGTS
YALTQLNLTEIVELDVSYNDFGNPISTNNVPEFLGSMKNIRYLDLSETSIFSGRVPPQLG
NLSNLRHLGLHLMHTDMYSTDISWLTRLHLLEYLDTSSVNLSTLHDWPVVVNMIPHLNYL
FFNDCSLPTANQTLAHINLTKLEILLLDWNYFGHPIASCWFWKVSSIKMLGLSGTYLDGP
FPDALGGMTSLEVLYFHDNGNAATMTVDLKNLCALQWLFLDGSLSSGNITEFMHKMPRCS
PNQLDYLSLRDNNMTGTLPNVMRHLDSLSHLLLSNNSISGHIPGSICMFQYMHRLDLSNN
FLEGELPPCSRISAAN
Download sequence
Identical sequences J3N927
OB11G23130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]