SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OB12G26870.1 from Oryza brachyantha 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OB12G26870.1
Domain Number 1 Region: 95-245
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 7.6e-17
Family Shiga toxin, A-chain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OB12G26870.1
Sequence length 325
Comment pep:novel chromosome:Oryza_brachyantha.v1.4b:12:15150236:15151213:1 gene:OB12G26870 transcript:OB12G26870.1 description:"rRNA N-glycosidase "
Sequence
MMAPPPPLPGQGSVQNNKERQNFINSRKMVKVYHSILSNISLEISSKSSQFVEKEPLKPR
GEHEDEEEEVSTKKDWKFQFLPRPAASQMSYKFRYPVTPSMGHFIVELQPPAHLARDVYK
PIKILFRSRDLYVLGFLHGNLWCLTRDVEVGDNDRQWVHYLPFHGGYGDRGLDCDHSTVK
LGSEGMMDSYLALSHYNPMHQNPGQVIRAVQTLVGNISEPARFLSLQRRAMKAFKEQETQ
MVKEKETQMVNDDIKAAPDNEKDEQQVYGKTKAHTDSSAMFTKWQSFCNYVRGRGTFLPS
PCCGIYSLEDVFSELGIMLRDAANA
Download sequence
Identical sequences J3NFC9
OB12G26870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]