SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|408403275|ref|YP_006861258.1| from Candidatus Nitrososphaera gargensis Ga9.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|408403275|ref|YP_006861258.1|
Domain Number - Region: 6-59
Classification Level Classification E-value
Superfamily PH domain-like 0.00189
Family VPS36 N-terminal domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|408403275|ref|YP_006861258.1|
Sequence length 92
Comment hypothetical protein Ngar_c06580 [Candidatus Nitrososphaera gargensis Ga9.2]
Sequence
MVDMIVLQNGENLIRRDSVELFSDGRRKFGKGMLYLTNTRLMFEMKNGMVPRLVALHTIQ
SVVPVKKNEFTMSYMNDDGTKISDGVTSEDWL
Download sequence
Identical sequences K0I8J4
gi|408403275|ref|YP_006861258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]