SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|408404596|ref|YP_006862579.1| from Candidatus Nitrososphaera gargensis Ga9.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|408404596|ref|YP_006862579.1|
Domain Number - Region: 4-57
Classification Level Classification E-value
Superfamily PH domain-like 0.0184
Family VPS36 N-terminal domain-like 0.024
Further Details:      
 
Domain Number - Region: 71-179
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0314
Family Helical scaffold and wing domains of SecA 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|408404596|ref|YP_006862579.1|
Sequence length 244
Comment hypothetical protein Ngar_c19900 [Candidatus Nitrososphaera gargensis Ga9.2]
Sequence
MIILQNGEQLIRKDGAELFSDEKKFGKGTLYLTNIRMMFETENGMVQRLIVLHSIQSVVP
VKKHEFTVSYMNDDSTGIFTDRYKIMDGEKCEDWIEDFRNICNTSMLSGANSVYSKSTTE
GRENRIESLQDDRQNVNDVVVDVNSKTLSWKKIEGWRKFPDEHIWQGTKRLDSMTNEEWH
AFKQESFALDDRLFKLKHEYLNAKKRGDKQRCAEIGEEMQIINLELTGRKVIPFKSITRE
QFSE
Download sequence
Identical sequences K0IKG8
gi|408404596|ref|YP_006862579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]