SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000059 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000059
Domain Number 1 Region: 76-180
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.45e-20
Family Synaptotagmin-like (S variant) 0.0024
Further Details:      
 
Domain Number 2 Region: 174-243
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000051
Family p120GAP domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000059   Gene: ENSGGOG00000000060   Transcript: ENSGGOT00000000060
Sequence length 244
Comment pep:novel chromosome:gorGor3.1:7:44893311:44904518:-1 gene:ENSGGOG00000000060 transcript:ENSGGOT00000000060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGWAHLTEVDPDEEVQGEIHLRLEVRPGARACRLRCSVLEASLTSAVAEPPRRGGCGEP
RVQWHQPNPLPPSSGQIVKKSCYPRWNETFEFELQEGAMEALCVEAWDWDLVSRNDFLGK
VVIDVQRLRVAQQEEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLWDKTVLPSIYYQPLVH
LLCHEVKLGMQGPGQLIPLIEETTSTECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSR
TSEA
Download sequence
Identical sequences ENSGGOP00000000059 ENSGGOP00000000059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]