SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000202 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000202
Domain Number 1 Region: 1281-1507
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.88e-41
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 2 Region: 311-423
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-29
Family Cadherin 0.0009
Further Details:      
 
Domain Number 3 Region: 744-849
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 635-742
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1531-1728
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.6e-28
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 6 Region: 205-309
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-26
Family Cadherin 0.00045
Further Details:      
 
Domain Number 7 Region: 416-538
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-25
Family Cadherin 0.00063
Further Details:      
 
Domain Number 8 Region: 845-959
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 9 Region: 538-639
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 103-203
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-18
Family Cadherin 0.0042
Further Details:      
 
Domain Number 11 Region: 953-1055
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000103
Family Cadherin 0.0097
Further Details:      
 
Domain Number 12 Region: 1208-1298,1496-1544
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 13 Region: 1861-1901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1732-1765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000152
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 1767-1813
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000937
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000202
Domain Number - Region: 2329-2572
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000915
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number - Region: 1911-1962
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00445
Family Hormone receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000202   Gene: ENSGGOG00000000205   Transcript: ENSGGOT00000000207
Sequence length 2860
Comment pep:novel chromosome:gorGor3.1:22:30854142:31029936:-1 gene:ENSGGOG00000000205 transcript:ENSGGOT00000000207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALCFPVPGGCAAAQHSALAAPTTLPACRCPPRPRPRCPGRPICPPPGGSVRLRLLCALRR
AAGAVRVGLALEAATAGTPSASPSPSPPLPPNLPASGRGSLKFPMPNYQVALFENEPAGT
LILQLHAHYTIEGEEERVSYYMEGLFDERSRGYFRIDSATGAVSTDSVLDRETKETHVLR
VKAVDYSTPPRSATTYITVLVKDTNDHSPVFEQSEYRERVRENLEVGYEVLTIRASDRDS
PINANLRYRVLGGAWDVFQLNESSGVVSTRAVLDREEAAEYQLLVEANDQGRNPGPLSAT
ATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATDRDQGQNAAIHYSILSGN
VAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGRPPLINSSGVVSVQVLDVNDNE
PIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLHYRLVDTASAFLGGGSAGPKNP
APTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPAMSSSTSVSITVLDVND
NDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSVITYQLTGGNTRNRFALSSQRGGG
LITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLINVTDANTHRPVFQSSHYTVSVSEDR
PVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPDSGIMYTMMELDYENQVAYTLTI
MAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSATDRDSG
PNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPTPLSAS
VEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQIVEGD
MRHFFQLDLLSGDLRAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDNPPMLP
DFQILFNNYVTNKSNSFPSGVIGRIPAHDPDVSDSLNYTFVQGNELRLLLLDPATGELQL
SRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITDDMLTNSITVRLENMSQEKFLSP
LLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNVTFSALLPGGVRGQFFPSEDLQE
QIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLRFDSSAPFLSSTTVLFRPIH
PINGLRCRCPPGFTGDYCETEIDLCYSDPCGANGRCHSREGGYTCECFEDFTGEHCEVDA
RSGRCANGVCKNGGTCVNLLIGGFHCVCPPGEYERPYCEVTTRSFPPRSFVTFRGLRQRF
HFTISLTFATQERNGLLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTTVAPKVPSGV
SDGRWHSVQVQYYNKPNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDIGNYSCAAQ
GTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFVGCMRNLSVDGKNVDMAGFIANNGT
QEGCAARRNFCDGRRCQNGGTCVNRWNMYLCECPLRFGGKNCEQAMPHPQLFSGESIVSW
SDLNVIISVPWYLGLMFRTRKEDSVLMEATSGGPTSFRLQILNNYLQFEVSHGPSDVESV
MLSGLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNKADIGGMLPGLTIRSMV
VGGASEDKVSVRRGFRGCMQGVRMGGTPTNVATLNMNNALKVRVKDGCDVEDPCTSSPCP
PNSRCHDAWEDYSCVCDKGYLGINCVDACHLNPCENMGACVRSPGSPQGYVCECGPSHYG
PYCENKLDLPCPRGWWGNPVCGPCHCAVSKGFDPDCNKTNGQCQCKENYYKPPAQDTCLP
CDCFPHGSHSRTCDMATGQCACKPGVIGRQCNRCDNPFAEVTTLGCEVIYNGCPKAFEAG
IWWPQTKFGQPAAVPCPKGSVGNAVRHCSGEKGWLPPELFNCTTISFVDLRAMNEKLSRN
ETQVDGARALQLVRALRNATQHTGTLFGNDVRTAYQLLGHVLQHESWQQGFDLAATQDAD
FHEDVIHSGSALLAPATRAAWEQIQRSEGGTAQLLRRLEGYFSNVARNVRRTYLRPFVIV
TANMILAVDIFDKFNFTGARVPRFDAIHEEFPRELESSVSFPADFFKPPEEKEGPLLRPA
GRRTTPQTTRPGPGTEREAPISRRRRHPDDAGQFAVALVIIYRTLGQLLPERYDPDRRSL
RLPHRPIINTPMVSTLVYSEGAPLPRPLERPVLVEFALLEVEERTKPVCVFWNHSLAVGG
TGGWSARGCELLSRNRTHVACQCSHTASFAVLMDISRRENGEVLPLKIVTYAAVSLSLAA
LLVAFVLLSLVRTLRSNLHSIHKHLAAALFLSQLVFVIGINQTENPFLCTVVAILLHYIY
MSTFAWTLVESLHVYRMLTEVRNIDTGPMRFYYVVGWGIPAIVTGLAVGLDPQGYGNPDF
CWLSLQDTLIWSFAGPIGAVIIVSQVVAMGAGLILPSRSSLLRTAFLLLLLISATWLLGL
LAVNHDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVRKHLKGVLGGRKLHLEDSATTRAT
LLTRSLNCNTTFGDGPDMLRTDLGESTASLDSIVRDEGIQKLGVSSGLARGSHGEPDASL
MPRSSKDPPGHDSDSDSELSLDEQSSSYASSHSSDSEDDGVGAEEKWDPARGAVHSTPKG
DAVANHVPAGWPDQSLAESDSEDPSGKPRLKVETKVSVELHREEQGSHRGEYPPDQESGG
AARLASSQPPEQRKGILKNKVTYPPPLTLTEQTLKGRLREKLADCEQSPTSSRTSSLGSG
GPDCAITVKSPGREPGRDHLNGVAMNVRTGSAQADGSDSE
Download sequence
Identical sequences ENSGGOP00000000202 ENSGGOP00000000202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]