SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000253 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000253
Domain Number 1 Region: 103-158
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000066
Family C-type lectin domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000253   Gene: ENSGGOG00000000257   Transcript: ENSGGOT00000000259
Sequence length 166
Comment pep:novel chromosome:gorGor3.1:12:9775531:9786030:-1 gene:ENSGGOG00000000257 transcript:ENSGGOT00000000259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSNFFHVIQIFEKSATLISKTEHIGFVIYSWRKSTTHLGSRRKFAISIYLPEVSLQKYD
CPFSGTSFVVFSLFLVCAMAGDVVYADIKTVRTFLLELPFPLQRSVSFNFSTVHKSCPAK
DWKVHKGKCYWIAETKSWNKSQNDCAINNSYLMVIQDITAMVRFNV
Download sequence
Identical sequences ENSGGOP00000000253 ENSGGOP00000000253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]