SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000360 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000360
Domain Number 1 Region: 480-595
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1524-1644
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-32
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 1180-1286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 4 Region: 317-421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 5 Region: 1697-1817
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.26e-31
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 6 Region: 999-1120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-30
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 7 Region: 1868-1987
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 2055-2158
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 140-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 10 Region: 839-942
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 11 Region: 659-768
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 1347-1462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-22
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 13 Region: 2408-2476
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 14 Region: 2465-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-18
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 2764-2835
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.16e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 2648-2716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-17
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 17 Region: 2824-2893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2523-2597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2705-2775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 20 Region: 1119-1183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000243
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2944-3012
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000337
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 2882-2939
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000361
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 23 Region: 2222-2289
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000101
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 426-494
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 944-1014
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 256-317
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 27 Region: 2580-2642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000403
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 2350-2412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000556
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 29 Region: 1293-1357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 30 Region: 76-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 31 Region: 601-661
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 32 Region: 1815-1884
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 33 Region: 2160-2233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 34 Region: 1469-1532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000472
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1643-1707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000162
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 36 Region: 1986-2050
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000391
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 37 Region: 774-834
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000229
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 38 Region: 3003-3060
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000486
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 39 Region: 2304-2360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 40 Region: 1-39
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000196
Family Spermadhesin, CUB domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000360   Gene: ENSGGOG00000000361   Transcript: ENSGGOT00000000369
Sequence length 3293
Comment pep:novel chromosome:gorGor3.1:8:2710816:3536502:-1 gene:ENSGGOG00000000361 transcript:ENSGGOT00000000369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLTGMNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDGSH
KNSVLSQGGVALVSDMCPDPGIPENGRRAGSDFSRVGANVQFSCEDNYVLQGSKSITCQR
VTETLAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCVWVITTTDPDKVIK
LAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIG
SPGFKAVYQEIEKGGCGDPGIPAYGKRMGSSFLHGDTLTFECPAAFELVGERVITCQQNN
QWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDV
EPQFDFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTT
FGQNECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESITCILQDGNVVWSSTV
PRCEAPCGGHLTASSGVILPPGWPGYYKDSLHCEWIIEAKPGHSIKITFDRFQTEVNYDT
LEVRDGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESD
SCLDPGIPVNGHRHGGDFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCG
GYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGS
FSEPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVP
AFSRRIGFHFGVGDSLTFSCFLGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGN
EGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLSEGDTVKVYDGKDSSSRPLG
TFTKNELLGLILNSTSNHLWLEFNTNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRD
EGHFTDTVVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCIAECGGQIHAATSGRILS
PGYPAPYDNNLHCTWIIEADPGKTISLHFIVFDTEMAHDILKVWDGPVDSDILLKEWSGS
ALPEDIHSTFNSLTMQFDSDFFISKSGFSIQFSTSIAATCNDPGMPQNGTRYGDSREAGD
TVTFQCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPY
PPGKECDWRVKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSYQGSQAPERIE
SSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTITYQCD
SGYKILDPSSITCVTGADGKPSWDQVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQIC
LYSITVPKEFVVFGQFAYFQTALNDLAELFDGTHAQARLLSSLSGSHSGETLPLATSNQI
LLRFSAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGY
LLQGSTALHCQSVPNALAQWNXTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWK
IIVTEGSGIQIQVISFATEQNWDSLEIHDGGDVTAPRLGSFSGTTVPALLNSTSNQLYLH
FQSDISVAAAGFHLEYKTVGLAACQEPALPSNSIKIGDRYMVNDVLSFQCEPGYTLQGRS
HISCMPGTVRRWNYPSPLCIATCGGTLSTLGGVILSPGFPGSYPNNLDCTWRISLPIGYG
AHIQFLNFSTEANHDFLEIQNGPYHTSPMIGQFSGTDLPAALLSTTHETFIHFYSDHSQN
RQGFKLAYQAYELQNCPDPPPFQNGYMINSDYSVGQSISFECYPGYILIGHPVLTCQHGI
NRNWNYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLITVPPGHGVYINFTLL
QTEAVNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFH
AFQLKKCQPPPAVPQAEMLTEDDDFEIGDFVKYQCHPGYTLVGTDTLTCKLSSQLQFEGS
LPTCEAQCPANEVRTGSSGVILSPGYPGNYFNSQTCSWSIKVEPNYNITIFVDTFQSEKQ
FDALEVFDGSSGQSPLLVVLSGNHTEQSNFTSRSNQLYLRWSTDHATSKKGFKIRYAAPY
CSLTHPLNNGGILNRTAGAVGSKVHYFCKPGYRMVGHSNATCRRNPLGMYQWDSLTPLCQ
AVSCGIPESPGNGSFTGNEFTLESKVVYECHEGFKLESSQQATAVCQEDGLWSNKGKPPT
CKPVACPSIEAQLSEHVIWRLVSGSLNEYGAQVLLSCSPGYYLEGRRLLQCQANGTWNIG
DERPGCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGS
ETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGQTP
VCVPITCGHPGNPAHGFTNGSEFNLNDVVNFTCNTGYLLQGVSRAQCRSNGQWSSPLPTC
RVVNCSDPGFVENAIRHGQQNFPESFEYGMSVLYHCKKGFYLLGSSALTCMANGLWDRSL
PKCLAISCGHPGVPANAILTGELFTYGAVVRYSCRGSESLIGNDTRVCQEDSHWSGPLPH
CTGSNPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGHQLRGSPERTCLLNGSWSGLQP
VCEAVSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPD
CTIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYLMEPITSATVRCTKDGMWNESKPV
CKAVLCPQPPPVQNGTVEGTDFRWGSSISYSCMDGYQLSHSAILSCEGRGVWKGEIPQCL
PVFCGDPGIPAEGRLSGKSFTYKSEVFFQCKSPFILVGSSRRICQADGTWSGIQPTCIDP
AHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHIQGSTTRTCLANLTWSGIQTECI
PHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCK
SKGVREVNETVTKTPVPSDVFFVNSLWKGYYEYLGKRQPATLTVDWFNATSSKVNATFSE
ASPVELKLTGIYKKEEAHLLLKAFQIKGQADIFVSKFENDNWGLDGYVSSGLERGGFTFQ
GDIHGKDFGKFKLERQDPLNPEQDSSSHYHGTSSGSVAAAILVPFFALILSGFAFYLYKH
RTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSGGOP00000000360 ENSGGOP00000000360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]