SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000451 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000451
Domain Number 1 Region: 367-445
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.49e-24
Family Intermediate filament protein, coiled coil region 0.00087
Further Details:      
 
Domain Number 2 Region: 134-169
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000152
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000451
Domain Number - Region: 188-280
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000575
Family Myosin rod fragments 0.0088
Further Details:      
 
Domain Number - Region: 249-365
Classification Level Classification E-value
Superfamily Prefoldin 0.0102
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000451   Gene: ENSGGOG00000000457   Transcript: ENSGGOT00000000460
Sequence length 490
Comment pep:novel chromosome:gorGor3.1:5:43306276:43310396:1 gene:ENSGGOG00000000457 transcript:ENSGGOT00000000460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRYSSSKHYSSSRSGGGGGGGGGGSSLRISSSKGSLGGGFSSGGFSGGSFSRGSSGGG
CFGGSSGGYGGLGGFGGGSFRGSYGSSSFGGGYGGSFGGGSFGGGSFGGGSFGGGSFGGG
FGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQ
GEPRDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEA
DINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAP
GVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRR
NVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNT
EYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSSGGHKSSSSGSV
GESSSKGPRY
Download sequence
Identical sequences ENSGGOP00000000451 ENSGGOP00000000451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]