SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000469 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000469
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.66e-58
Family BAR domain 0.000000544
Further Details:      
 
Domain Number 2 Region: 288-348
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000469   Gene: ENSGGOG00000000478   Transcript: ENSGGOT00000000481
Sequence length 351
Comment pep:novel chromosome:gorGor3.1:15:63572480:63637028:1 gene:ENSGGOG00000000478 transcript:ENSGGOT00000000481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTIFLKELVQKIQQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQP
NPVFKAESPVTKDLKYIKNSTKLLKFKQTDKKLIGCLTLYMKTHLGELRFSIQGNALIEV
GESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGK
IPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQ
SKLQMRISAYAGNPLQQQRLQPKKKKTPKINLINTQRKKIMWTGSNIPMDQPCCRGLYDF
EPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences ENSGGOP00000000469 ENSGGOP00000017095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]