SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000521 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000521
Domain Number 1 Region: 373-577
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000521   Gene: ENSGGOG00000000529   Transcript: ENSGGOT00000000534
Sequence length 722
Comment pep:novel chromosome:gorGor3.1:18:6770094:6946815:1 gene:ENSGGOG00000000529 transcript:ENSGGOT00000000534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVEDSGGVVLTAYHSYARAQPPNAESRCAPRAAASHPLSRKSIPRCRRINRMLSNESLH
PPAFSRSNSEASVDSASMEDFWREIESIKDSSMGGQEEPPPAEVTPVDEGELEAEWLQDV
GLSTLISGDEEEDGKALLSTLTRTQAAAVEKRYNTYTQTMRKKNKQSIRDVRDIFGVSES
PPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSD
SVAVLETIPVLPVHSNGSPEPGQPVQNAISDDDYLEKNIPPEAEELSFEVSYSEMVTEAL
KRNKLKKSEIKKEDYVLTKFIVQKTRFGLTEAGDLSAEDMKKIRHLSLIELTAFFDAFGI
QLKRNKTEKVKGRDNGIFGVPLTVLLDSDRKKDPGVKVPLVLQKFFEKVEESGLESEGIF
RLSGCTAKVKQYREELDAKFNADKFKWDKMCHREAAVMLKAFFRELPTSLFPVEYIPAFI
SLMERGPHVKVQFQALHLMVMALPDANRDAAQALMTFFNKVIANESKNRMSLWNISTVMA
PNLFFSRSKHSDYEELLLANTAAHIIRLMLKYQKILWKVPSFLITQVRRMNEATMLLKKQ
LPSVRKLLRRKTLERETASPKTSKVLQKSPSARRMSDVPEGVIRVHAPLLSKVSMAIQLN
NQTKAKDILAKFQYENRILHWQRAALSFLNGKWVKKEREESTEANRSPKHVFLFTIGLDI
ST
Download sequence
Identical sequences ENSGGOP00000000521 ENSGGOP00000000521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]