SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000553 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000553
Domain Number 1 Region: 430-737
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-78
Family p120GAP domain-like 0.0000333
Further Details:      
 
Domain Number 2 Region: 235-312
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000573
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 
Domain Number 3 Region: 306-422
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000775
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000000553
Domain Number - Region: 890-986
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000553   Gene: ENSGGOG00000000560   Transcript: ENSGGOT00000000566
Sequence length 1011
Comment pep:novel chromosome:gorGor3.1:19:15742387:15758910:-1 gene:ENSGGOG00000000560 transcript:ENSGGOT00000000566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPSPSRTSQTQPTATSPLTSYRWHTGGGGEKAAGGFRWGRFAGWGRALSHQESMVSTQ
PAPRSIFRRVLSAPPKESRTSRLRLSKALWGRHKNPPPEPDPEPEQEAPELEPEPGLEPP
TPQIPEAPTPNVPVWDIGGFTLLDGKLVLLGGEEEGPRRPRVGSASSEGSIHVAMGNFRD
PDRMPGKTEPETAGPNQVHNVRGLLKRLKEKKKARLELRDGPPSALGSRESLATLSELDL
GAERDVRIWPLHPSLLGEPHCFQVTWTGGSRCFSCRSAAERDRWIEDLRRQFQPTQDNVE
REETWLSVWVHEAKGLPRAAAGAPGVRAELWLDGALLARTAPRAGPGQLFWAERFHFEAL
PPARRLSLRLRGLGPGSAVLGRVALALEELGAPRAPAAGLERWFPLLGAPVGAALRARIR
ARRLRVLPSERYKELAEFLTFHYGRLCGALEPALPAQAKEELAAAMVRVLRATGRAQALV
TDLGTAELARCGGREALLFRENTLATKAIDEYMKLVAQDYLQETLGQVVRRLCASTEDCE
VDPSKCPASELPEHQARLRNSCEEVFETIIHSYDWFPAELGIVFSSWREACKERGSEVLG
PRLVCASLFLRLLCPAILAPSLFGLAPDHPAPGPARTLTLIAKVIQNLANRAPFGEKEAY
MGFMNSFLEEHGPAMQCFLDQVAMVDVDAAPSGYQGSGDLALQLAVLHAQLCTIFAELDQ
TTRDTLEPLPTILRAIEEGQPVLVSVPMRLPPPPAQVHSSLSAGEKPGFLAPRDLPKHTP
LISKSQSLRSVRRSESWARPRPDEERPLRRPRPVQRTQSVPVRRPARRRQSAGPWPRPKG
SLSTGPAPRARPWTRDSASLPRKPSVPWQRQMDQPQNRNQALGTHRPVNKLAELQCEVAA
LREEQKVLSRLVESLSTHIRALTEQQEQLRGQLQDLDSRLRAGSSEFDSEHNLTSNEGHS
LKNLEHRLNEMEKTQAQLRDAVQSLQLSPRTRGSWSQPQPLKAPCLNGDTT
Download sequence
Identical sequences G3QE65
ENSGGOP00000000553 ENSGGOP00000000553 XP_004060248.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]