SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000763 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000763
Domain Number 1 Region: 253-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.16e-79
Family Protein kinases, catalytic subunit 0.00000000136
Further Details:      
 
Domain Number 2 Region: 114-241
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-38
Family SH2 domain 0.00000641
Further Details:      
 
Domain Number 3 Region: 76-118
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000174
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000763   Gene: ENSGGOG00000000775   Transcript: ENSGGOT00000000779
Sequence length 529
Comment pep:novel chromosome:gorGor3.1:1:28595702:28608566:-1 gene:ENSGGOG00000000775 transcript:ENSGGOT00000000779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEHGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
Download sequence
Identical sequences G3QER4
XP_004025316.1.27298 ENSGGOP00000000763 ENSGGOP00000000763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]