SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000800 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000800
Domain Number 1 Region: 403-548
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.7e-50
Family Lamin A/C globular tail domain 0.000000118
Further Details:      
 
Domain Number 2 Region: 306-382
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.36e-18
Family Intermediate filament protein, coiled coil region 0.0000199
Further Details:      
 
Domain Number 3 Region: 30-62
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000628
Family Intermediate filament protein, coiled coil region 0.0022
Further Details:      
 
Domain Number 4 Region: 81-174
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000244
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000800   Gene: ENSGGOG00000000813   Transcript: ENSGGOT00000000817
Sequence length 664
Comment pep:novel chromosome:gorGor3.1:1:135117776:135143666:1 gene:ENSGGOG00000000813 transcript:ENSGGOT00000000817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK
LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN
CSIM
Download sequence
Identical sequences G3QEU9 P02545
gi|27436946|ref|NP_733821.1| NP_733821.1.87134 NP_733821.1.92137 XP_018879777.1.27298 ENSGGOP00000000800 ENSP00000357283 ENSP00000357283 ENSGGOP00000000800 9606.ENSP00000357283 ENSP00000355292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]