SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000813 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000813
Domain Number 1 Region: 207-546
Classification Level Classification E-value
Superfamily DNase I-like 4.17e-76
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000021
Further Details:      
 
Domain Number 2 Region: 664-680,718-879
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000813   Gene: ENSGGOG00000000824   Transcript: ENSGGOT00000000830
Sequence length 888
Comment pep:novel chromosome:gorGor3.1:X:127017597:127018744:1 gene:ENSGGOG00000000824 transcript:ENSGGOT00000000830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVEGMEMKGPLREPCALTLAQRNGQYELIIQLHEKEQHVQDIIPINSHFRCVQEAEETLL
IDIASNSGCKIRVQGDWIRERRFEIPDEEHCLKFLSAVLAAQKAQSQLLVPEQKDSSSWY
QKLDTKDKPSVFSGLLEFEDNFSSMNLDKKINSQSQPTGIHREPPPPPSSVNKMLPREKE
ASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQTFRFFVGTWNVNGQS
PDSGLEPWLNCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMAVERGLHSKAKYKK
VQLVRLVGMMLLIFARKDQCRYIRDIATETVGTGIMGKMGNKGGVAVRFVFHNTTFCIVN
SHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNIMKHEVVIWLGDLNYRLCMPDAN
EVKSLINKKDLQRLLKFDQLNIQRTQKKAFVDFNEGEIKFIPTYKYDSKTDRWDSSGKCR
VPAWCDRILWRGTNVNQLNYRSHMELKTSDHKPVSALFHIGVKVVDERRYRKVFEDSVRI
MDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFSFIPKLNDSQYCKP
WLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSGEDKIEDILVLHLDRGKDYFLTISG
NYLPSCFGTSLEALCRMKRPIREVPVTKLIDLEEDSFLEKEKSLLQMVPLDEGASERPLQ
VPKEIWLLVDHLFKYACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLI
FLEALPEPVICYELYQRCLDSAYDPRICRQVISQLPRCHRNVFRYLMAFLRELLKFSEYN
SVNANMIATLFTSLLLRPPPNLMARQTPSDRQRAIQFLLGFLLGSEED
Download sequence
Identical sequences G3QEV9
ENSGGOP00000000812 ENSGGOP00000000813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]