SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000881 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000881
Domain Number 1 Region: 160-237
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000117
Family Gar1-like SnoRNP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000881   Gene: ENSGGOG00000000894   Transcript: ENSGGOT00000000900
Sequence length 456
Comment pep:novel chromosome:gorGor3.1:4:173644630:173683811:-1 gene:ENSGGOG00000000894 transcript:ENSGGOT00000000900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTQPPLQSFEGSPDAGQTVEVKPAGEQPLQPVLNAVAAGTPAPQPQPPAESPACGDCVTS
PGAAEPARAPDSLETSDSDSDSDSETDSDSSSSSSSSSSSSSSSSSSCISLPPVLSDGDD
DLQVEKENKNFPLKTKDELLLNELPSVEELTIILPEDIELKPLGMVSSIIEQLVIIESMT
NLPPVNEETVIFKSDRQAAGKIFEIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPS
MKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRKKLK
SEFNEPGEDFTEVHQNWNAHSSASEHAKGYRNREFTRGFSRARYPRSCHGRPPPQHFYNS
EHMVSQETSGFPSQRQDNPIMPQYPFPLPMFDMHNFPLRPPPPPPPPPVNMGWATPNMAA
HPLLNLPYSLPPPPPPPPLPPPPSSGDSNSHFGPYY
Download sequence
Identical sequences ENSGGOP00000000881 ENSGGOP00000000881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]