SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000923 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000923
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-28
Family C-type lectin domain 0.000000238
Further Details:      
 
Domain Number 2 Region: 317-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-16
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 262-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000104
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 565-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 200-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000306
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 441-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000032
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 503-569
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 378-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 9 Region: 642-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000862
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 10 Region: 697-762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000542
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 11 Region: 162-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000923   Gene: ENSGGOG00000000935   Transcript: ENSGGOT00000000943
Sequence length 830
Comment pep:novel chromosome:gorGor3.1:1:148793865:148834215:-1 gene:ENSGGOG00000000935 transcript:ENSGGOT00000000943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANCQKAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYC
QNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADN
EPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDTSCSKQGECLETIGN
YTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYKVNGPS
KLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
PEVVQCTASGGWTAPAPVCKAVQCQHLEAPNKGTMDCVHPLTAFAYGSSCKFECQPGYRV
RGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGF
MLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNE
GLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPVGSSSYKSTCQFIC
DEGFSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPKQGSLDCSDTRGEFNVGSTCHF
SCNKGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPG
TFGFNTTCYFGCNAGFTLIGDNTLSCRPSGQWTAVTPACKAVKCSELHVNKPIAMNCSNV
WGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVA
STIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences ENSGGOP00000000923 ENSGGOP00000000923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]