SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000942 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000942
Domain Number 1 Region: 116-258
Classification Level Classification E-value
Superfamily L domain-like 1.84e-31
Family U2A'-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000942   Gene: ENSGGOG00000000954   Transcript: ENSGGOT00000000963
Sequence length 2326
Comment pep:novel chromosome:gorGor3.1:9:103844184:103934856:1 gene:ENSGGOG00000000954 transcript:ENSGGOT00000000963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKGSQQKIFSKAKIPSSSHCPIPSSMSNMRSRSLSPLIGSETLPFRSGGQWCEQVEIAD
ENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIEN
LEKCVQLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNE
IEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFT
IFHLRSLESLESQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEI
KNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELTRACQKQYELEQELAFYK
IDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNTFATESYIIDNAQAVQIKKMEPDE
QLRNDHMNLRGHMSLDMQLEDKEKKISAAQTRLSELHDEIEKAEQQILRATEEFKQLEEA
IQLKKISEAGKDLLYKQLSGRLQLVNKLRQEALDLELQMEKQKQEIAGKQKEIKDLQIAI
DSLDSKDPKHSHMKAQKRGKEQQLDIMSKQYQQLESRLDEILSRIAKETEEIKDLEEQLT
EGQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLRDEKETLLQRLTEVEQER
DQLEIVAMDAENMRKELAELESALQEQHEVNASLQQTQGDLSAYEAELEARLNLRDAEAT
QLKEELEKVTRLTQLEQSALQAELEKERQALKNALGKAQFSEEKEQENSELHAKLKHLQD
DNNLLKQQLKDFQNHLNHVVDGLVRPEEVAARVDELRRKLKLGAGEMNIHSPSDVLGKSL
ADLQKQFSEILARSKWERDEAQVRERKLQEEMALQQEKLATGQEEFRQACERALEARINF
DKRQHEARIQQMENEIHYLQENLKSMEEIQGLTDLQLQEADEEKERILAQLRELEKKKKL
EDAKSQEQVFGLDKELKKLKKAVATSDKLATAELTIAKDQLKSLHGTVMKINQERAEELQ
EAERFSRKAAQAARDLTRAEAEIELLQNLLRQKGEQFRLEMEKTGVGTGANSQVLEIEKL
NETMERQRTEITRLQNVLDLTGTDNKGGFENVLEEIAELRREVSYQNDYISSMADPFKRR
GYWYFMPPPPSSKVSSHSSQATKDSGVGLKYTASTPVRKPRPGQQDGKEGSQPPPASGYW
VYSPIRSGLHKLFPNRDADSGGDSQEESELDDQEEPPFVPPPGYMMYTVLPDGSPVPQGM
ALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGPPPPNFSIPFIPMGVLHCNVPEHHN
LENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEMEELHHNIDDLLQEKKSLECEVEEL
HRTVQKRQQQKDFIDGNVESLMTELEIEKSLKHHEDIVDEIECIEKTLLKRRSELREADR
LLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRALETAVNLVKADQQLRS
LQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERN
EDHHLQVLKESEVLLQAKRAELENLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQA
KADLQEALRLGETEVTEKCNHIREVKSLLEELSFQKGELNVQISERKTQLTLIKQEIEKE
EENLQVVLRQMSKHKTELKNILDMLQLENNELQGLKLQHDQRVSELEKTQVAVLEEKLEL
ENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWE
KKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLSLHNDISAMQQQLQ
EKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQK
EEETKQQQLQVLQNEIEENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEK
ELTDQKSKLDQVLSKVLAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGE
LLALQKEADSMRADFSLLRNQFLTERKQAEKQVASLKEALKIQRSQLEKNLLEQKQENSC
MQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMANQKDLERRQMEISDAMRTL
KSEVKDEIRTSLKNLNQFLPELPDLEAILERNENLEGELESLKENLPFTMNEGPFEEKLN
FSQVHIMRKDEHWRGEALREKLRHREDRLKAQLRHCMSKQAEVLIKGKRQTEGTLHSLRR
QVDALGELVTSTSADSASSPSLSQLESSLTEDSQLGQNQEKNASAR
Download sequence
Identical sequences ENSGGOP00000000942 ENSGGOP00000000942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]